(data stored in ACNUC30630 zone)

EMBL: CP001738.PE384

CP001738.PE384       Location/Qualifiers
FT   CDS_pept        444726..446651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0393"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="SMART: PBS lyase HEAT domain protein repeat-
FT                   containing protein; KEGG: afw:Anae109_2123 heat
FT                   repeat-containing PBS lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95993"
FT                   /db_xref="GOA:D1A2H3"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H3"
FT                   /inference="protein motif:SMART:SM00567"
FT                   /protein_id="ACY95993.1"
FT                   /translation="MNLDGIDWRRLKHAYGRATAIPRLLREAASDDAGQAGEAVERLES
FT                   VLWETEEAMVYSASPTVVPFLAELAAAPRTHHRPRLLRLMFDIADAVWELEEIAALGGD
FT                   SDLLNFPAQLEWARAARTAVQAQAPTLARLLEDGDPEVRAEAARILARFPGHGSDPLPA
FT                   LQDRAAREEDVGTAASMILSVGELARRRRQRPVAWLRERLRAARAREVRVAAGVALARC
FT                   GAGLDDAACEAIGAELRAERSALDDQPWTSSQGRAEFLLSALSDDADTHLAVAVQALRT
FT                   TDSAERLKALPLAGEVMLTWRAGPQTLLPSLVELCADPEASVRIAATRQIVQGGPRIAD
FT                   VADRLAELLDDPEAEVSGNAAWALSLVGDARAIPTVTAELAEPRLPIPIGRALEGLRGA
FT                   AQELIPHVAAYLRAPRQNPQLPGDTLIGVLIGLRSWGPRALPLLPELIGVLERGTAVPA
FT                   CAWTLGTLGSAAAAAVPHLRGLLEPDADPIARDAAAWALWQITGDAEEPLRVLGEGLKG
FT                   GLSDHAVELLCGLGDRAAPVVKLIRRHLKSSLYGTGAACALYRITGDAERTLPRLIEGV
FT                   EATPVGMLAVQCLGDIGPAAAPALAAIEEIATSPRVLATRIEKDLIATDLAYRDMAVAA
FT                   AERIRR"
     atgaaccttg acggcatcga ctggcgacgt ctcaagcacg cctacggcag ggccacggcc        60
     atcccccgcc tgctgcgcga ggcggcttca gacgacgccg gccaggccgg ggaggcggtc       120
     gagagactgg agtcggtgct gtgggagacc gaggaggcga tggtctattc ggcgagcccg       180
     accgtcgtcc cgttcctggc cgagctggcg gctgcgccgc gaacccacca tcggccgcgg       240
     ctgctccgcc tcatgttcga tatcgccgac gcggtgtggg agctggagga gatcgccgct       300
     ctgggcggcg acagcgacct tctcaacttt cccgcccagc tggaatgggc gcgcgccgcc       360
     cggaccgcgg tccaggctca ggcgccgacg ctggcgcggc tgctggagga cggggacccg       420
     gaggtccgtg ccgaagccgc tcgcatcctg gcccgctttc ccggccacgg ctcagatccg       480
     cttccggccc tgcaggacag ggcggctcgc gaggaggacg tcggcaccgc cgcgagcatg       540
     atcctctcgg tgggggagct ggcccgccgg cgccggcagc ggccggtcgc ctggctgcgg       600
     gaacggctcc gggcggcgcg ggcgcgggag gtccgcgtgg cggcgggcgt ggccctggcg       660
     cgttgcgggg cggggctcga cgacgccgca tgcgaggcga tcggcgcgga gctgagagcc       720
     gagcggtccg cacttgatga tcaaccgtgg acgtcctccc agggccgcgc cgagttcctg       780
     ctgtcggctc tcagcgacga cgcagacact catctcgccg tcgcggtgca ggcgctgcga       840
     accaccgact ccgccgaacg cctcaaggcg ctcccactgg ccggtgaggt gatgctgacc       900
     tggcgtgccg gcccgcagac cttgctgccg tcactggtgg aactgtgcgc cgatcccgag       960
     gcgtccgtgc gcatcgccgc cacccggcag atcgtgcaag gcgggccgcg catcgccgat      1020
     gtggccgatc ggctggccga actgctggac gatccggaag cggaggtcag cgggaacgcc      1080
     gcctgggcgt tgagcctcgt cggcgacgcc cgggcgatcc ccacggtgac cgccgagctg      1140
     gccgagccgc ggctgccgat ccccatcggc cgcgcgctgg aaggcctgcg gggcgccgcc      1200
     caagagctga tcccgcacgt cgccgcgtat ctgcgggcgc cgcggcagaa cccccagctc      1260
     cccggcgaca cgctgatcgg cgtgctgatc gggctgaggt cctggggccc ccgggcattg      1320
     ccgctgctgc cggagctgat cggagtgctg gaacgcggaa cggcggtccc cgcctgtgcg      1380
     tggaccctgg gaaccctcgg ctccgccgcc gccgcggccg tcccgcattt gcgcggcctc      1440
     ctggagccgg acgccgaccc catcgcccgg gacgcggcgg cctgggccct gtggcagatc      1500
     accggggacg ccgaggaacc gctgcgagtg ctgggcgagg gcctgaaagg cggactgtcc      1560
     gaccacgcag tcgagctgtt gtgcggactc ggtgaccggg ccgctccagt ggtgaagctg      1620
     atcagaaggc atctgaaaag ttcgttgtac ggcacgggcg cggcctgcgc cctgtatcgc      1680
     atcaccggcg acgccgaacg gacccttccc cgcctgatcg agggcgtcga ggccacaccg      1740
     gtcggaatgc tggcggtgca gtgcctgggc gacatcggcc ctgccgccgc ccctgctctc      1800
     gccgccatcg aggagatcgc caccagtccc cgcgtgctgg ccacccgtat cgaaaaagat      1860
     ctgatcgcca ccgatctggc ctaccgggac atggccgtgg ccgccgcaga acgcatccgg      1920
     cgatga                                                                 1926
//

If you have problems or comments...

PBIL Back to PBIL home page