(data stored in ACNUC30630 zone)

EMBL: CP001738.PE387

CP001738.PE387       Location/Qualifiers
FT   CDS_pept        complement(447603..448946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0396"
FT                   /product="Glutamate dehydrogenase (NADP(+))"
FT                   /EC_number="1.4.1.4"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase; Glu/Leu/Phe/Val
FT                   dehydrogenase dimerisation region; KEGG: ank:AnaeK_3118
FT                   glutamate dehydrogenase (NADP(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95996"
FT                   /db_xref="GOA:D1A2H6"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H6"
FT                   /inference="protein motif:PRIAM:1.4.1.4"
FT                   /protein_id="ACY95996.1"
FT                   /translation="MHERLEPIFEEVVRRNPGELEFHQAVREVFESVGPVIAKHPEFTE
FT                   AKIIERICEPERQIIFRVPWTDDKGEVHVNRGFRVEFNSALGPYKGGLRFHPSVNLGIV
FT                   KFLGFEQIFKNSLTGLPIGGGKGGSDFDPKGRSDAEIMRFCQSFMTELYRYLGEHTDVP
FT                   AGDIGVGSREVGYLFGQYKRITNRYESGVLTGKPLLVGGAQVRPEATGYGLAFFVDEML
FT                   KARGASFDGRRVVVSGSGNVAIYAIEKVTQLGGVVVACSDSSGYVLDEKGIDLPLLKEI
FT                   KEVRRQRISEYAKARAGSGAVFVPGRSVWEVPCEVALPSATQNEITGADARTMVGNGCI
FT                   AVGEGANMPTMPEAIRIFREAGVAFGPGKAANAGGVATSALEMQQNASRDSWSFEYSEN
FT                   RLRQIMQDIHTRCLETADAYGMPGDYVAGANIDGFTRVAEAMLTLGLI"
     gtgcacgaga ggcttgagcc gatctttgag gaggtcgtcc ggcgcaaccc tggtgagctg        60
     gagttccacc aggccgtacg cgaggtgttc gagagcgtgg ggccggtgat cgccaagcac       120
     ccggagttca ccgaggcaaa gatcatcgag cggatctgcg aaccggaacg gcagatcatc       180
     ttccgggtgc cgtggaccga cgacaagggc gaggtccacg tcaaccgggg gttccgggtc       240
     gagttcaaca gcgccctggg cccctacaag gggggcctgc gcttccaccc ctcggtgaac       300
     ctgggcatcg tgaagttcct gggctttgag cagatcttca aaaacagcct gaccggcctg       360
     cccatcgggg gcggcaaggg cggctccgac ttcgacccca agggccgctc ggacgcggag       420
     atcatgcgct tctgccagag cttcatgacc gagctgtacc ggtacctggg cgagcacacc       480
     gacgtccccg ccggggacat cggggtgggc tcccgcgagg tcggctacct gttcggccag       540
     tacaagcgca tcaccaaccg ctacgagtcc ggggtgctga ccggcaagcc gctgctggtg       600
     ggcggggcgc aggtgcgccc ggaggccacc gggtacgggc tggccttctt cgtggatgag       660
     atgctcaagg cccgcggcgc ctccttcgac gggcggcggg tggtcgtctc cgggtccggc       720
     aacgtggcca tctacgccat cgagaaggtc acccagctcg gcggcgtcgt ggtggcctgc       780
     tcggactcct ccggctacgt gctggacgaa aagggcatcg acctgccgct gctgaaggag       840
     atcaaggagg tccgccggca gcggatctcc gagtacgcca aggcgcgggc cggcagcggc       900
     gcggtcttcg tccccggccg cagcgtctgg gaggtcccct gcgaggtggc gctgccgtcg       960
     gccacccaga acgagatcac cggcgccgac gcccgcacca tggtcggcaa cggctgcatc      1020
     gcggtgggcg agggcgccaa catgcccacc atgcccgagg cgatccgcat cttccgggag      1080
     gccggggtgg ccttcgggcc gggcaaggcg gccaacgccg gcggggtggc caccagcgcc      1140
     ctggagatgc agcagaacgc cagccgcgac tcctggtcgt ttgagtactc cgagaaccgc      1200
     ctgcgccaga tcatgcagga catccacacc cgctgcctgg agaccgccga cgcctacggc      1260
     atgccgggcg actacgtggc cggggccaac atcgacggct tcacccgggt ggccgaggcg      1320
     atgctgaccc tcggtctcat ctag                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page