(data stored in ACNUC30630 zone)

EMBL: CP001738.PE389

CP001738.PE389       Location/Qualifiers
FT   CDS_pept        450432..451487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95998"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95998.1"
FT                   /translation="MGRHPIVVVDIKEFGRRPDGAQKQLRKRLYRVMWNALDAAGIVRE
FT                   DVHPPQDRGDGAFWILPTWVSPAELTGPLVRQLHRELQQDADSDPEGAMRVRVALHIGK
FT                   VSKDSNGWVGTDLNTACRLVDADELRRVLELGARPLMALILSRQWREEVRHRHIEGLDL
FT                   KSGWPVRIAVKEVADTAWIHLPGHEDLTVRLWRIQKRWEELLALEEQVRTRRDEIAERL
FT                   TSVPDMPDPPPELRRGRDLLPLWELVELDAEVFQQATERWWKRITKLGRRVEKMKAERD
FT                   ELRKTIEAFQARQNQSGLAEDLHLSAAYRRARDLLWHAPCDLPRAKAAVDDYIQEIWRK
FT                   LHHDLNAGGRA"
     atgggacgcc accccatagt cgtcgtggac atcaaggaat tcggcaggcg tcccgacggt        60
     gcccaaaaac agctgcgcaa acggctctac cgggtcatgt ggaacgcgct ggacgccgcc       120
     gggatcgtcc gggaagacgt ccaccccccg caggaccgag gcgacggggc gttctggatc       180
     ctgcccacct gggtatcgcc ggccgaactg accggcccgc tcgtccggca actgcaccgg       240
     gaactgcagc aggacgccga cagcgacccc gaaggcgcca tgcgcgtccg cgtggcgctg       300
     cacatcggca aagtgagcaa agacagcaac ggctgggtgg gaacggatct gaacaccgcc       360
     tgccgcctgg tggacgccga cgagctgcgc cgcgtgctgg aactgggcgc acgccccctc       420
     atggcgttga tcctctcccg gcagtggcgg gaagaagtgc ggcaccggca catcgaggga       480
     ctggacctga agtccggctg gccggtacgc atcgccgtca aagaggtggc ggacaccgcc       540
     tggatccacc tgccgggcca tgaagacctc accgtgcggc tgtggcggat ccaaaaacgg       600
     tgggaggagc tgctggccct ggaagagcag gtccgcaccc ggcgcgatga gatcgccgaa       660
     cgactgacct cggtgcccga catgcccgac ccgccgcccg agctgcgccg cggccgggac       720
     ctgctgccgc tctgggagct ggtcgaactg gacgccgagg tcttccagca ggccaccgag       780
     cgctggtgga agcggatcac gaaactgggg cggcgcgtcg agaagatgaa ggccgagcgc       840
     gacgaactgc gcaagaccat cgaggcattc caggcgagac agaaccaaag cgggctggcc       900
     gaggacctcc acctgtcggc ggcctaccgc cgcgcccgcg acctgctgtg gcacgccccc       960
     tgcgacctgc cccgggccaa agccgcggtc gacgactaca tccaggagat atggcgcaag      1020
     ctgcaccatg acctgaacgc cggggggcgg gcatga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page