(data stored in ACNUC30630 zone)

EMBL: CP001738.PE396

CP001738.PE396       Location/Qualifiers
FT   CDS_pept        complement(460221..461273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0405"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   ferredoxin; KEGG: bam:Bamb_4089 oxidoreductase FAD/NAD(P)-
FT                   binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96005"
FT                   /db_xref="GOA:D1A2I5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2I5"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACY96005.1"
FT                   /translation="MTTAEATEVRPVTLVTSDGERLEFGCAPGRSVLEAAAEAGAALPA
FT                   SCKQGTCGSCHASVAEGDYELGAHSPAALPPERRAAGEVLLCRTFPRGPLSVTLPYDGS
FT                   RILRGGIPRRQAVIVALETVACETVRLELRAEPTEDGGTDCQFDPGQFVELQVPGHDAK
FT                   RAYSLANTGNWEGRMEFYIRLRPGGLFSTYLRERARPGQTLTAFGPQGAFGLRETGLRP
FT                   RWFVAGGTGLAPLLSMVRHMAEWQEPQPARLLLGVNTEEEVFGTAELDAVAAELPGFSH
FT                   RVCVWRPGPSWQGPVGTPADLLAADLAEAPAAPDIYVCGPPPMVDAVVQVAARAGVPAE
FT                   HVFYERFLPT"
     atgaccaccg ccgaggccac ggaagtccgg ccggtgacgc tggtgacctc cgacggggag        60
     cggctggagt tcggctgcgc gcccggccgg agcgtgctgg aggccgccgc cgaggccggg       120
     gccgccctgc cggcctcctg caagcagggc acctgcgggt cctgccacgc ctcggtcgcc       180
     gagggggact acgagctggg cgcccacagc ccggcggcgc tgccgccgga gcggcgcgcc       240
     gccggggagg tgctgctgtg ccgcaccttc ccccgcggcc cgctgtcggt gacgctcccc       300
     tacgacgggt cccggatcct gcgcggcggg ataccgcggc ggcaggccgt catcgtcgcg       360
     ctggagaccg tcgcctgcga aacggtgcgg ctggagctgc gggcagagcc caccgaggac       420
     ggggggaccg actgccagtt cgacccgggg cagttcgtgg aactgcaagt tcccggccac       480
     gacgccaaac gggcctactc cctggccaac accggcaact gggagggccg catggagttc       540
     tacatccggc tgcggccggg cgggctgttc tccacctatc tgcgggagcg ggcccgtccc       600
     gggcagacgc tcaccgcgtt cggcccgcag ggcgccttcg gcctgcggga aaccgggctg       660
     cggccccgct ggttcgtggc cggcgggacc ggcctggcgc cgctgctgtc gatggtgcgg       720
     cacatggccg aatggcagga gccccagccg gcgcggctgc tgctgggcgt caacaccgaa       780
     gaagaggtgt tcgggacggc cgagctggac gcggtggcgg ccgagctgcc cggcttcagc       840
     caccgggtct gcgtgtggcg gcccggcccc tcctggcagg ggccggtggg caccccggcg       900
     gacctgctgg cggcggacct ggccgaggcg ccggccgcgc ccgacatcta cgtgtgcggc       960
     ccgccgccca tggtcgatgc cgtcgtccag gtggcggcac gggccggggt ccccgccgag      1020
     cacgtctttt acgaacggtt cctgccgacc tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page