(data stored in ACNUC30630 zone)

EMBL: CP001738.PE41

CP001738.PE41        Location/Qualifiers
FT   CDS_pept        complement(46117..47484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0042"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: pha:PSHAb0091
FT                   cell divisionFtsK/SpoIIIE domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95650"
FT                   /db_xref="GOA:D1ADE0"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADE0"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ACY95650.1"
FT                   /translation="MPEGLVLLVNLLRLLARAVVFCLRHPIVSGAVVGAGWLAWRYGWH
FT                   VPALVGLVVVVGLGVWAAVDRASFVRRVYRPAWSWWRGWWVYRRHWQPVLVTAGLTKTH
FT                   RGREYLPTLRRVECGAASDRLLVQMLRGQAPDAWEKVAANLAHGFGATLVRVREGDRPG
FT                   RVWLEFVRIDALASPIPALPIPDASAVDLRAVEVGRLEDGSPWRLRLLGTHVLVAGATG
FT                   SGKGSVLWSVIRGVLPLMVAGLVEVWAIDPKRMELSYGRVLFERFGRYSSDPGGGMVAL
FT                   LEEAAGDMNARADQFAGHTRTFVPSVEHPFRLIVVDELAFLTAYSPERDLRKRAESALA
FT                   ILTSQGRSVGYCVLGAQQDARKEVNNLRNLFPDRIALRLDEDEQVDMVLGDGARDRGAL
FT                   ADQISTVPEVGAGVGFVRLETCPDPVRVRAAYVSDEDIRQMVAYALSGGTYRPEAA"
     atgcccgagg gcctggtcct gctcgtcaac ctgctccgcc tcctggcccg cgcggtggtg        60
     ttctgcctgc gccacccgat cgtctccggt gccgtggtgg gggccggctg gctggcctgg       120
     cggtacggct ggcacgtgcc cgccctcgtc ggcctggtgg tcgtggtcgg cctgggggtg       180
     tgggcggcgg tggatcgggc gtcgttcgtg cgccgggtct accgtccggc gtggtcgtgg       240
     tggcggggct ggtgggtgta ccggcggcac tggcaaccgg tcctggtcac cgccggactc       300
     acgaaaaccc accgtggccg cgagtacctg ccgacgctgc ggcgggtcga gtgcggggcc       360
     gcgtcggacc ggctgctggt gcagatgctt cgcgggcagg ctcccgacgc ctgggagaag       420
     gtggcggcca acctggcgca cggtttcggc gcgaccctgg tgcgggtccg ggagggggat       480
     cggccgggcc gtgtgtggct ggagttcgtc cgcatcgacg ccctggcctc cccgattccg       540
     gcgctgccga ttccggacgc atctgcggtg gacctgcggg cggtggaggt cggccgcctg       600
     gaggacggtt cgccgtggcg gctgcggctc ctcggcacgc acgtcctggt ggcgggcgcg       660
     accgggtcgg gcaagggttc ggtgttgtgg tcggtgatcc gtggcgtgtt gccgttgatg       720
     gtcgccgggc tggtcgaggt gtgggccatc gaccccaaac ggatggagct gtcctacggc       780
     cgcgtgttgt tcgagcggtt cggccggtac tcctccgacc ctggcggtgg gatggtcgcg       840
     ctgctggagg aggccgctgg cgacatgaac gcccgcgccg accagttcgc cggccacacc       900
     cgcacgttcg tcccctcggt ggagcatccg ttccggctga tcgtggtgga tgagctggcg       960
     ttcctgaccg cctacagccc cgaacgcgac ctgcgcaagc gggccgaatc cgcgttggcg      1020
     atcttgacca gtcagggccg gtcggtgggc tactgcgtgc tcggcgccca gcaggacgcc      1080
     cgcaaagagg tcaacaacct gcgcaacctg ttccccgacc ggatcgcgct gcggctggat      1140
     gaggacgaac aggtcgacat ggtcctgggc gacggggcac gggaccgggg cgcgctggcc      1200
     gaccagatct cgaccgttcc ggaggtcggg gccggtgtcg ggttcgtccg gctggagacc      1260
     tgcccggatc cggtgcgggt gcgggcggcg tacgtgtcgg acgaggacat ccggcagatg      1320
     gtcgcctacg ccctgtcggg tggcacctac cggccggagg ccgcatga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page