(data stored in ACNUC30630 zone)

EMBL: CP001738.PE423

CP001738.PE423       Location/Qualifiers
FT   CDS_pept        490758..491621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mno:Mnod_6880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96032"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2L2"
FT                   /inference="protein motif:COG:COG3662"
FT                   /protein_id="ACY96032.1"
FT                   /translation="MTAPEEPVPPAPLGPGSFLWDYSGLRLAAITDISAFVLQAMHPAI
FT                   GAAAERLTDLDTRRLSRAVHDFVSIRPWVYGEQGTRHLLPAGPLAWAHLATFYVTVTAA
FT                   RYFSAEPMTLDREQRIFEEFLLLGRLRGVPARMLPSTMADYWAYFEDMLTHTLVPHPVA
FT                   HRVLDRLGGFSSTVPVTLRPLLVPFGLRGGWFTHLVTVGTLPQAARTKLGLTWTADDEH
FT                   RLRAVGTLFTRVLPHLPERLRYAPSAYQARRTSRMQRSPRGPRHLRLTDTCPVVAGCRG
FT                   VRRAVR"
     atgacggcgc cggaagagcc cgtgcccccg gccccgctcg ggccaggctc gttcctgtgg        60
     gactacagcg gcctgcgcct ggcggcgatc accgacatca gcgcgttcgt gctgcaggcc       120
     atgcacccgg ccatcggcgc cgccgccgag cggctgaccg acctggacac ccgccggctg       180
     agccgggccg tgcacgactt cgtctccata cggccctggg tgtacgggga gcaggggacg       240
     cgtcatctcc tgcccgccgg tcctttggcc tgggcgcacc ttgcgacctt ctacgtcacg       300
     gtcaccgcgg cgcggtactt ttccgccgaa ccgatgactt tggaccggga gcagcggatc       360
     ttcgaggagt tcctcctgct gggacggctt cggggagtgc cggcgcggat gctgccgtcc       420
     acgatggccg actactgggc ctacttcgag gacatgctga cccacaccct ggtaccgcac       480
     ccggtggcgc atcgggtgct ggaccggctg ggcggcttct cctcgactgt cccggtgacg       540
     ctgcgcccgc tgctcgtccc gttcggcctg aggggcggct ggttcaccca cctggtcacc       600
     gtcggcaccc ttccgcaggc ggcccgcacc aagctcggcc tgacctggac ggcagacgac       660
     gaacaccggc tgcgcgctgt tggaacgctc tttacccgcg tccttcccca cctgcccgaa       720
     cgcctccgct acgccccttc cgcctaccag gcccgccgca cctcccggat gcagcggagc       780
     ccacggggac ctcggcatct gcggcttacc gacacatgcc cggtggtggc cgggtgccgg       840
     ggcgtccggc gagcggtgcg ctga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page