(data stored in ACNUC30630 zone)

EMBL: CP001738.PE43

CP001738.PE43        Location/Qualifiers
FT   CDS_pept        complement(47962..48228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95652"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADE2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95652.1"
FT                   /translation="MAGRVSALSLPVGSGASSEFKAFRSRTPLFTVSAGRLLVTLTLPE
FT                   RLGAGEVEFARRLAEQAAAYAVEVERLYRSGRSSARTGKGAAA"
     atggcggggc gggtgtcggc gctgtcgctg ccggtcgggt ccggggcctc cagcgagttc        60
     aaggcgttcc gctcgcgcac accgctgttc accgtctcgg ccggtcggct gctggtcacc       120
     ctgacccttc cggaacggct cggggccggt gaggtcgagt tcgcccggcg gctggccgaa       180
     caggcggcgg cctacgcggt tgaggtcgaa cggctctacc gctccggacg ctcctcggcc       240
     cggaccggca agggggcggc ggcgtga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page