(data stored in ACNUC30630 zone)

EMBL: CP001738.PE445

CP001738.PE445       Location/Qualifiers
FT   CDS_pept        520980..522431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0456"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: pca:Pcar_1701
FT                   aldehyde dehydrogenase, NAD- linked"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96054"
FT                   /db_xref="GOA:D1A3C9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3C9"
FT                   /inference="protein motif:PRIAM:1.2.1.8"
FT                   /protein_id="ACY96054.1"
FT                   /translation="MSDPKTAGGLRPEWARSQVYIGGRWREPAAGRITPVENPATETVI
FT                   GTAADADAADVQTAVSAAAAAFPAWSSLPPAGRLEALERFHAALERRRHLLVETTVAEV
FT                   GAPVRVAREAHVDTGLAVLRAYLDAAAEVAWEERVGNSLVVREGIGVAACITPWNYPFY
FT                   QVLAKIGGALAAGAAVVLKPAELTPLSAYLIADAADEAGLPPGVFNLVPGTGPIVGEAL
FT                   VAHPAVDAVSFTGSTRVGSHVAALAAATVKRVSLELGGKSASIILPGADLEPAVRASVE
FT                   AAMLNSGQTCTAWTRLLVPRAAFEAALRLAAARAEEFTVGDPTRPETDLGPLVSAAQRR
FT                   TVTGFIERAAAGGARIVTGGPQRPAGLVRGHYVQPTVVTDVAPDAEIVQEEVFGPVLTV
FT                   QSYEDVDEAITLANGTPYGLAGAVWGDRDAAVAVARRLRTGQVDINGGAFNPAAPFGGY
FT                   RRSGNGRELGRWGIEEFLETKALQL"
     atgagcgacc cgaagacagc cggcggcctt cgccccgagt gggcgcgctc gcaggtgtac        60
     atcggcggcc ggtggcgcga accggccgcc gggcggatca cgccggtcga gaacccggcg       120
     accgaaacgg tgatcgggac cgccgcggac gccgacgccg cggacgtcca gaccgcggtg       180
     tccgcggcgg cggccgcctt ccccgcctgg tcgagcctgc cgccggccgg gcggctggag       240
     gcgctggagc ggttccacgc cgccttggaa cgccgccggc acctgctggt ggagaccacg       300
     gtcgccgagg tcggcgcgcc ggtgcgggtg gcgcgggagg cgcacgtgga caccgggctg       360
     gccgtgctgc gcgcctacct ggacgccgcc gcggaggtgg cctgggagga gcgggtcggc       420
     aactccctgg tggtgcgcga gggcatcggc gtcgccgcct gcatcacccc gtggaactac       480
     cccttctacc aggtcctcgc caagatcggc ggggcgctgg cggccggtgc cgcggtggtg       540
     ctcaaaccgg ccgagctgac gccgctgtcg gcgtacctga tcgccgatgc cgccgacgag       600
     gcgggcctgc ccccgggggt gttcaatctc gttcccggga cgggaccgat cgtgggggag       660
     gcgctggtgg cccacccggc cgtcgacgcg gtgtccttca ccgggtccac ccgggtcggc       720
     tcccacgtcg cggcccttgc cgccgccacc gtcaaacgcg tcagcctgga gctgggcggc       780
     aagtccgcca gcatcatcct ccccggcgcc gacctcgaac cggccgtccg ggcgtccgtc       840
     gaggcggcca tgctcaactc cggccagacc tgcacggcgt ggacccggct cctggtgccg       900
     cgcgccgcct tcgaagcggc gctccggctc gccgcggcgc gcgccgaaga gttcacggtc       960
     ggcgacccga cccggcccga gacggacctc ggccctctcg tctccgcggc ccagcgccgc      1020
     accgtcaccg ggttcatcga acgggccgcc gccggcggcg cccgcatcgt caccgggggc      1080
     ccgcagcgcc ccgcgggcct tgtacgcggc cactacgtgc agccgaccgt cgtcaccgac      1140
     gtcgcccccg acgccgagat cgtccaagag gaggtgttcg gccccgtcct gaccgtccag      1200
     tcctatgagg acgtcgacga ggcgatcacc ctcgccaacg gcacccccta cggcctggcc      1260
     ggcgcggtat ggggagaccg ggacgcggcc gtggcggtcg cccgccgcct gcgcaccggc      1320
     caggtcgaca tcaacggcgg cgccttcaac ccggccgccc ccttcggcgg ctaccggcgt      1380
     tccggaaacg gccgcgaact gggacggtgg gggatcgaag agttcctgga gaccaaggcc      1440
     ctgcaactgt ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page