(data stored in ACNUC30630 zone)

EMBL: CP001738.PE461

CP001738.PE461       Location/Qualifiers
FT   CDS_pept        complement(539302..539760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0473"
FT                   /product="cysteine dioxygenase type I"
FT                   /note="PFAM: cysteine dioxygenase type I; KEGG:
FT                   mxa:MXAN_0927 cysteine dioxygenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96070"
FT                   /db_xref="GOA:D1A3E5"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3E5"
FT                   /inference="protein motif:PFAM:PF05995"
FT                   /protein_id="ACY96070.1"
FT                   /translation="MTLSTPIAPAHLRPAEIARTLAAAPQEWIHRVRLNIPERWYERLH
FT                   HDEHHEVWLLSWMPGQSTGLHDHGGSRGAFAVALGSLDEYDLHTRRTLTVGQFREFGAD
FT                   HIHEVANTTQAPAVSVHVYSPPLTSMNRYDLTPAGRLVRLAVERADQW"
     atgaccttga gcactccgat cgcacccgcc cacctgcgcc cggccgagat cgcccgcacc        60
     ctggccgccg ccccgcagga atggatccac cgggtccggc tcaacatccc cgaacgctgg       120
     tacgaacgcc tgcaccacga cgagcaccac gaggtctggc tgctgagctg gatgcccggc       180
     cagtccaccg gcctgcacga ccacggcggc tcccgcggcg ccttcgcggt ggccctcggc       240
     agcctggacg aatacgacct gcacacccgg cgcaccctca ccgtgggcca gttccgcgag       300
     ttcggcgccg accacatcca cgaggtcgcc aacaccaccc aggccccggc ggtcagcgtg       360
     cacgtctact cgccgccgct gacctcgatg aaccgctacg acctcacccc cgccggccgg       420
     ctggtgcgcc tcgccgtgga acgggccgac caatggtga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page