(data stored in ACNUC30630 zone)

EMBL: CP001738.PE468

CP001738.PE468       Location/Qualifiers
FT   CDS_pept        complement(545003..545383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96077"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3F2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96077.1"
FT                   /translation="MPKAQFRRKARALQRLGEENMLFKAINPVRPRDQNRRRAHQQDLI
FT                   RRIHRQYGQRNPDFSRRLISRITNARDMQLDHVHELQLGGADLRNNLRYLDAFTNREVG
FT                   NQIRQQIRNLPDGTPIRIRIIE"
     atgccgaagg cgcagttccg ccgcaaagcc agggcgctgc agcggctggg cgaagagaac        60
     atgctgttca aggcgatcaa ccccgtgcgc ccccgcgatc agaaccgccg gagagcccac       120
     cagcaggacc tcatcagacg gatccacaga cagtacggac agcgcaaccc cgacttctcc       180
     cgacgactga tctcccgcat caccaacgcc agggacatgc agctcgacca cgtccatgag       240
     ctccaactcg gcggagcgga cctgcgtaat aatctcaggt atctggacgc tttcaccaac       300
     cgagaagtcg gcaaccaaat tcgacaacag atcagaaatc tcccagacgg cactccgatc       360
     aggattagaa tcatagaatg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page