(data stored in ACNUC30630 zone)

EMBL: CP001738.PE488

CP001738.PE488       Location/Qualifiers
FT   CDS_pept        complement(562603..563283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0500"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: dar:Daro_0834 LuxR response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96097"
FT                   /db_xref="GOA:D1A3H2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3H2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACY96097.1"
FT                   /translation="MSAEQSQDQRTIRVFLLDDHEVVRRGVAALLSAEDDIEIVGEAGT
FT                   AEQALARIPAARPDVAVLDVRLPDGDGVSVCREIRSRMPEVACLMLTSFEDEEALFDAV
FT                   MAGAAGYVLKQIHGSDLVGAIRTVASGQSLLDPQSTAKMLQRVRERAARKDPLASLTDQ
FT                   ERQILELIGEGLTNRQIGERMFLAEKTVKNYVSNLFTKLDMRRRTQAAALAAQLKANRG
FT                   SLSR"
     atgagcgccg agcagtcgca ggatcaacgg accatccggg tgttcctgct ggacgaccac        60
     gaggtcgtgc ggcggggtgt ggccgcgttg ctgtccgccg aggacgacat cgagatcgtc       120
     ggcgaggccg ggaccgccga acaggcgctg gcccgcattc cggcggcccg tcccgacgtg       180
     gccgtgctgg atgtgcggct gcccgacggc gacggggtga gcgtgtgccg ggagatccgc       240
     tcccggatgc ccgaggtcgc ctgcctgatg ctgacctcgt tcgaggatga ggaggctctt       300
     ttcgacgcgg tcatggcggg cgcggccggc tatgtgctca agcagatcca cggctcggac       360
     ctggtcggcg ccatccgcac ggtggcctcc ggccagtcgc tgctggaccc gcagagcacc       420
     gccaagatgc tgcagcgggt gcgcgagcgc gccgcccgca aggacccgct ggcctcgttg       480
     acggatcagg agcggcagat tctggaactg atcggcgaag ggctgaccaa ccggcagatc       540
     ggcgagcgca tgttcttggc cgaaaaaacc gtcaagaact acgtttcgaa tctcttcacc       600
     aagctcgaca tgcgccgccg cacccaggcc gccgcgctgg ccgcccagct caaggccaac       660
     cggggcagcc tgtcccgctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page