(data stored in ACNUC30630 zone)

EMBL: CP001738.PE490

CP001738.PE490       Location/Qualifiers
FT   CDS_pept        565335..565910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_2920 DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96099"
FT                   /db_xref="GOA:D1A3H4"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3H4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96099.1"
FT                   /translation="MAVLEGKAGDKTRGEHRGFPRPHLAAPLTEPPAARYVWAAARLGL
FT                   AWIFLWAFLDKTFGLGHGTPAAKAWLEGGSPTEGFLKNAASGPFADFYHGLAGMAWVDW
FT                   LFMLGLLGIGTALALGIGMRIAAASGTLLMVMMWTAVLPPENNPILDDHIIYALVLIGL
FT                   ALVKAGDTLGLGAMWERTALVRRFPILK"
     atggccgtcc tggaaggaaa agccggcgac aaaactcgcg gtgagcatcg cggattcccc        60
     cgtccgcacc tggccgcccc gctgaccgaa ccccctgccg cccggtacgt gtgggcggcg       120
     gcccggctgg gactggcctg gatcttcctg tgggcgttcc tggacaagac cttcggcctg       180
     ggccacggca ccccggcggc caaggcgtgg ttggagggcg gcagcccgac cgagggattc       240
     ctcaagaacg ccgcgagcgg cccgttcgcc gacttctacc acggcctggc cggcatggcc       300
     tgggtggact ggctgttcat gctgggcctg ctcggcatcg gcaccgcgct ggccctcggc       360
     atcggcatgc ggatcgccgc cgccagcggc acgctgctga tggtgatgat gtggaccgcc       420
     gtgctgcccc ccgaaaacaa cccgatcctg gacgaccaca tcatctacgc cctcgtcctg       480
     atcggcctgg ccctggtcaa ggccggagac accctcggcc tgggcgcgat gtgggagcgc       540
     accgccctgg tccgccgctt cccgatcctg aagtga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page