(data stored in ACNUC30630 zone)

EMBL: CP001738.PE512

CP001738.PE512       Location/Qualifiers
FT   CDS_pept        589462..590490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0524"
FT                   /product="Phenol 2-monooxygenase"
FT                   /EC_number="1.14.13.7"
FT                   /note="PFAM: methane/phenol/toluene hydroxylase; KEGG:
FT                   reh:H16_B0540 phenol hydroxylase P1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96121"
FT                   /db_xref="GOA:D1A3J6"
FT                   /db_xref="InterPro:IPR003430"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3J6"
FT                   /inference="protein motif:PRIAM:1.14.13.7"
FT                   /protein_id="ACY96121.1"
FT                   /translation="MQYELRTQVIEPVRATYTPLVERRGDRPASRYEEGTVDLQATEHF
FT                   HYRPLWDPAHELYDPGYSVLKLTDPYSFADPRQYYYAPYVTARAQMFDAFSRTLDYIDD
FT                   HGLFGRMAQEWRDLMIAALLPIRHYEGGAQLISAEGARFAYGTSVEQCLSYAAFDRIGN
FT                   AQMLSRVGLALGEGDTGPLTEARQSWLERAELQPLRRYVEELLVERDWAVSAFALDLAD
FT                   RLLYPLLYRHLDNAALAAGQSALSLVAQHLHAWFTDHRKWVDALVAAWTGDSEHGAANT
FT                   EALAAIVRRRLPQAVSAVANLAAAADAAVDTGARAAAEEQAERLRADLAAAGIPTQHKE
FT                   QA"
     gtgcagtatg aactgcggac ccaggtgatc gaaccggtcc gagcgaccta cacccctctg        60
     gtggagcgac gcggcgaccg gcccgcctcc cgctacgagg agggcacggt cgatctgcag       120
     gcgaccgagc acttccacta ccggccgctg tgggaccccg cccacgagct gtacgacccg       180
     ggctactcgg tgctcaagct caccgacccc tactccttcg ccgacccccg gcagtactac       240
     tacgcgccct acgtcaccgc ccgggcccag atgttcgacg ccttcagccg caccctcgac       300
     tacatcgacg accacgggct gttcggccgg atggcgcagg agtggcggga cctgatgatc       360
     gcggcgctgc tgccgatacg gcactacgag ggcggggccc agctgatctc cgccgagggc       420
     gcccgcttcg cctacggcac cagcgtggag cagtgcctgt cgtacgccgc cttcgaccgg       480
     atcggcaacg cccagatgct cagccgcgtc gggctggcgc tcggcgaggg ggacaccggc       540
     ccgctgaccg aggcccgcca aagctggctg gagcgggccg agctgcagcc gctgcgccgc       600
     tacgtggaag agctgctggt ggagcgggac tgggcggtca gcgcgttcgc cctggacctg       660
     gccgaccggc tgctgtaccc gctgctgtac cggcacctgg acaacgccgc actggccgcc       720
     gggcagagcg cgctgagcct ggtggcccag cacctgcacg cctggttcac cgatcaccgc       780
     aagtgggtgg acgccctggt ggccgcctgg accggcgaca gcgaacacgg cgccgccaac       840
     accgaggcgc tggccgccat cgtccgtcgc cgcctgccgc aggcggtgtc ggccgtggcg       900
     aacctggccg ccgccgccga cgcggccgtc gacaccggcg cccgggccgc cgccgaggaa       960
     caggccgagc ggctgcgcgc ggacctggcc gccgccggca tccccaccca gcacaaggag      1020
     caggcatga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page