(data stored in ACNUC30630 zone)

EMBL: CP001738.PE513

CP001738.PE513       Location/Qualifiers
FT   CDS_pept        590487..590792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0525"
FT                   /product="monooxygenase component MmoB/DmpM"
FT                   /note="PFAM: monooxygenase component MmoB/DmpM; KEGG:
FT                   reu:Reut_B5682 monooxygenase component MmoB/DmpM"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96122"
FT                   /db_xref="GOA:D1A3J7"
FT                   /db_xref="InterPro:IPR003454"
FT                   /db_xref="InterPro:IPR036889"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3J7"
FT                   /inference="protein motif:PFAM:PF02406"
FT                   /protein_id="ACY96122.1"
FT                   /translation="MTGTAPATGRPRTVGVDLQQNNEETRYVVEAIAKDNPDATIRHLP
FT                   GLIKIQTPGTLVIRRETVEELLGRPWETHEFQLSIVSYYGHVDEWDDDQIVIKWSH"
     atgaccggca ccgcccccgc caccggacgg ccccgcaccg tgggggtcga cctgcagcaa        60
     aacaacgagg agacccgcta cgtcgtcgag gcgatcgcaa aggacaaccc cgacgccacc       120
     atccggcacc tgccgggcct gatcaagatc cagacccccg ggacgctggt gatccgcaga       180
     gagacggtcg aggagctgct cggccggccc tgggagaccc acgagttcca gctgtcgatc       240
     gtctcctact acggccatgt ggacgagtgg gacgacgacc agatcgtcat caagtggagc       300
     cactga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page