(data stored in ACNUC30630 zone)

EMBL: CP001738.PE521

CP001738.PE521       Location/Qualifiers
FT   CDS_pept        596877..597620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0533"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   oca:OCAR_6782 transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96130"
FT                   /db_xref="GOA:D1A3K5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3K5"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACY96130.1"
FT                   /translation="MDGGLRSVLRALDLLDCFLTEDELGVADIARRLGVAKSTAHRLLT
FT                   TLCARGFAEQNPQTGHYRLGFHLYELGQLAVSRTDLHQAALPLLEELRERTGCTIHLAV
FT                   PDGPEIIYLERLHSLRGMRLFHGVSRRLPAHCTSSGKVIAAFDPAVARARAAAGFTRLT
FT                   SRSIPDAARFDRELAKVRRVGYAVNSDEAKHGLTSVAAPVRDHTGRARAAISLVGPTAE
FT                   VLGSVERHARLAGAAAHRLSRILCL"
     gtggacggcg ggctgcgatc ggtgctgcgg gccctggacc tgctggactg cttcctcacc        60
     gaagacgagc tgggagtggc cgacatcgcg cgccggctgg gggtggccaa atccaccgcg       120
     caccggctgc tgaccaccct gtgcgcccgc ggcttcgccg aacagaaccc gcagaccggg       180
     cactaccggc tcggcttcca cctctatgag ctgggccagc tggcggtcag ccgcaccgat       240
     ctgcaccagg ccgcgctgcc gctgctggag gagctgcgcg agcgcaccgg ctgcaccatc       300
     cacctggccg tgcccgacgg gccggagatc atctacctgg aacggctgca cagcctgcgg       360
     ggcatgcggc tgttccacgg ggtcagccgc cggctgccgg cgcactgcac cagctccggc       420
     aaggtgatcg cggccttcga cccggcggtg gcccgcgccc gcgccgccgc cggattcacc       480
     cgcctgacca gccgctccat cccggacgcg gcgcgtttcg accgggagct ggccaaggtg       540
     cgccgggtcg ggtacgcggt caacagcgat gaggccaagc acgggctgac ctcggtggcg       600
     gccccggtgc gcgaccacac cgggcgggcc cgcgcggcga tctcgctggt cgggccgacc       660
     gccgaggtgc tcggctcggt ggagcggcac gcccgcctgg ccggcgccgc cgcgcaccgg       720
     ctctcccgca tcctgtgcct gtga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page