(data stored in ACNUC30630 zone)

EMBL: CP001738.PE534

CP001738.PE534       Location/Qualifiers
FT   CDS_pept        611351..612631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0546"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   dvm:DvMF_3051 protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96143"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3L8"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ACY96143.1"
FT                   /translation="MRYSRAAFYLDFDNVFGGLFKLDPDVAIQFASNPGVWLQRLSTTL
FT                   TVDAPRRWLVLRCYLNPAGWVDYHPPLGEPSRLQFFRFRSSFISAGFEVIDCPRYNATK
FT                   NGADIRIAVDVVDALSADVTYDEFVIASGDSDMTPLLQRLRRADRRTVVMSSVDAAEAF
FT                   ISIADRTINGQQLLELVQGEPVGVEDDEYDAVAAELDGIGGDHTYAGAVPSDHARAYEY
FT                   FRSVVADKYNNASEPLNMANLAAQLRSELGPVIDETGWFGFGGFARAVESLKLPNLRMS
FT                   KHEIWDESRHSPPADAVATVPRVTLPEPVERLTALINLPRLPQGWWPMIYQTLADYASS
FT                   HQFNLTQCTSWTRDRLREQGFAINRNSVSFVVRGAAFGGCPLYRQPPPTAAEIGEAFVN
FT                   NVLTRVDGEILTEEEIEMVRTWLGGYS"
     gtgcgatact ctcgggctgc attttatctt gactttgata atgtgttcgg tgggcttttt        60
     aagctggatc cggatgtggc gatccagttc gcaagcaacc cgggagtatg gctgcaacgt       120
     ctgtcgacca cgctgacggt ggatgctccg cggcgttggc tggtgctgcg ctgctatctc       180
     aacccggccg gctgggtgga ttaccatccc ccgctgggag agccgtcacg gctgcagttt       240
     tttcgattca gatcctcgtt tattagtgcc ggtttcgaag tcattgactg ccctcgctac       300
     aacgccacga agaacggtgc ggacatcagg atcgccgtgg acgtcgtcga tgcgctatcg       360
     gccgacgtca cgtacgatga gttcgtcatc gcctccggcg attccgacat gacaccattg       420
     ctgcagcggc tgcgcagggc cgaccggcgg accgtggtca tgtcatcggt ggacgcggcc       480
     gaggcgttca tttcgatcgc cgaccgcacg ataaatggtc agcagctact ggagctggtt       540
     caaggcgaac cggtcggcgt cgaggacgat gagtacgatg ccgtggccgc cgagctcgat       600
     ggcatcggcg gtgatcacac atacgccggt gctgtgccga gcgaccatgc cagggcgtat       660
     gaatacttcc gctcagtggt cgccgacaaa tacaataatg cttccgagcc cctgaacatg       720
     gcgaatttgg cggcccagct gcgcagtgag ctgggaccgg tgatcgacga aaccggctgg       780
     ttcggcttcg gcggtttcgc acgggcggtg gaaagtttga aacttcccaa tctgcgaatg       840
     tcgaagcatg agatatggga tgagagtcgg cactctcccc ccgcggacgc ggtggccacg       900
     gtaccgcgcg tcaccctgcc ggagcccgtg gaacgcctga cggcgttgat caatctgccc       960
     cggctgccac agggctggtg gccgatgatc tatcagacgc tggccgacta tgccagttcc      1020
     catcagttca atttgacgca gtgcacgagc tggacgcgag accggcttcg ggaacagggg      1080
     ttcgccatca atcgcaacag cgtctccttc gttgtgcggg gagccgcgtt cggcggatgc      1140
     ccgctgtacc gtcagccccc gcccactgcg gcggagatcg gagaggcttt cgtgaacaat      1200
     gttctcactc gcgtcgatgg ggaaatcttg acggaagaag agatcgagat ggtccggacc      1260
     tggcttgggg gatattccta g                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page