(data stored in ACNUC30630 zone)

EMBL: CP001738.PE540

CP001738.PE540       Location/Qualifiers
FT   CDS_pept        618152..619066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_3751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96149"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3M4"
FT                   /inference="protein motif:COG:COG3662"
FT                   /protein_id="ACY96149.1"
FT                   /translation="MSKCPLTFLSDEPAARGSTGKACKVPSTEVTPLGPDSLTWRFFGD
FT                   TRLLLVGPRAAVLQNMLPALGQGVLEHSVFFSETFARLKRSAGPILNTVYGGEDAPAIG
FT                   RQVRDYHHHVKGELPDGGRYHALDPETYYWAHATFVDHMIYGVETFIRPLDEAEKRRIY
FT                   EESKTWYRMYGVSDRPMPEDWEGFQAYWKHMLEEVLIAHKTARYGVGYTTKGLPAPRRF
FT                   PKKLWRAVSPPLNKAASFLTIGGLPPRARELLELPWSAEDERRYRRFAARVRRAGRHWP
FT                   LLPEAVRYFPQARKAFARARAAR"
     ttgagtaaat gtccacttac cttcctgtcg gatgagcccg ccgcccgcgg cagtaccgga        60
     aaggcctgca aggtgccctc gaccgaagtg accccgctcg gcccggactc gctgacctgg       120
     cggttcttcg gggacacccg gctgctgctg gtcggtcccc gggccgccgt gctgcagaac       180
     atgctgcccg ccctcggcca gggcgtgctg gagcactcgg tgttcttctc cgagaccttc       240
     gcccggctca agcgctcggc cggccccatc ctcaacaccg tctacggcgg cgaggacgcc       300
     cccgccatag gacggcaggt ccgcgactac caccaccacg tcaagggcga gctgcccgac       360
     ggcggccgct accacgccct ggacccggag acctactact gggcgcacgc cacgttcgtc       420
     gaccacatga tctacggggt cgagacgttc atccgccccc tcgacgaggc ggagaaacgg       480
     cggatctacg aggagtccaa gacctggtac cgcatgtacg gggtcagcga ccggcccatg       540
     cccgaggact gggagggctt ccaggcgtac tggaagcaca tgctcgaaga ggtcctcatc       600
     gcccacaaga ccgcccgcta cggcgtcggc tacaccacca agggcctgcc cgccccccgc       660
     cgcttcccca aaaagctgtg gcgggccgtc agcccgccgc tgaacaaggc cgcctccttc       720
     ctgaccatcg gcggcctgcc gccacgggcc cgcgagctgc tggagctgcc ctggagcgcc       780
     gaggacgaac gccgctaccg gcgctttgcc gcccgggtgc ggcgcgcggg ccgccactgg       840
     ccgctgctgc cggaggcggt gcgctacttc ccgcaggccc gcaaggcctt cgcccgcgcc       900
     cgcgccgccc gctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page