(data stored in ACNUC30630 zone)

EMBL: CP001738.PE543

CP001738.PE543       Location/Qualifiers
FT   CDS_pept        623116..624258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0555"
FT                   /product="glycoside hydrolase family 25"
FT                   /note="PFAM: glycoside hydrolase family 25; SMART:
FT                   glycoside hydrolase family 25; KEGG:
FT                   N,O-diacetylmuramidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96152"
FT                   /db_xref="GOA:D1A3M7"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3M7"
FT                   /inference="protein motif:PFAM:PF01183"
FT                   /protein_id="ACY96152.1"
FT                   /translation="MKRLTAVVAMGVSAAVMAAGAAAAAPTPGHGLRPGEAYAGAGNPE
FT                   RRAGGVGAAQVPAGLKGVDVSSYQGPNVDWAALKQNGVRFAFVKATEGAKVKGDPDSGY
FT                   VNPYFKDQYNGARKAGLIRGAYHFALPHKSGGARQADYFINNGGGWSTGGGTLPGVLDI
FT                   EFNPYDNGLDTCYGLKPAQMVGWIRAFSNRYRKRTGRYPIIYTNAYWWNKCTNNNTSFG
FT                   NHPLWQAHYGSGPVTPPAGWKTYTFWQYAAGTGATGNPSVFNGSLKALRKLAAQARTGF
FT                   TKVNAGPEPRKKGKKLTVVGRLHYHNGTAWRPLAKRKVSIWFRARGTSKWVRKAVVTTN
FT                   GKGRFRRKFIARKGGYWRAKFAGGPKFFGVTSGSDYVDVR"
     atgaagcgtc tgacagccgt tgtcgccatg ggcgtctccg ccgccgtcat ggcggccggt        60
     gcggcggccg ccgcgccgac gccggggcac gggctgcgtc ccggtgaggc gtacgccggg       120
     gccggcaacc ccgagcgacg ggccggcggg gtcggggccg cgcaggtccc ggccgggctg       180
     aagggcgtgg acgtctccag ctaccagggg ccgaacgtcg actgggcggc gctcaagcaa       240
     aacggcgtgc gcttcgcctt cgtcaaggcc accgaaggcg ccaaggtcaa gggcgacccc       300
     gacagcggct acgtcaaccc ctacttcaag gaccagtaca acggggcgcg caaggccggc       360
     ctgatccggg gcgcctacca tttcgccctg ccgcacaagt cgggcggcgc ccggcaggcg       420
     gactacttca tcaacaacgg cggcggctgg agcacgggag gcgggacgct ccccggcgtg       480
     ctcgacatcg agttcaaccc ctacgacaac gggctggaca cctgctacgg cctcaagccc       540
     gcccagatgg tcggctggat ccgcgccttc agcaatcgtt accgcaagcg caccggccgt       600
     taccccatca tctacaccaa cgcctactgg tggaacaaat gcactaacaa caacaccagt       660
     ttcggcaacc accccctctg gcaggcgcac tacggctctg ggcccgtcac cccgcccgcc       720
     ggatggaaga cctacacctt ctggcagtac gcggccggca ccggcgccac cggcaacccg       780
     agcgtcttca acggctccct gaaagccctg cgcaagctcg ccgcccaggc ccgcaccggc       840
     ttcaccaagg tgaacgccgg ccccgagccc aggaagaagg gcaagaagct gaccgtcgtg       900
     ggccggcttc actaccacaa cggcaccgcc tggcgtcccc tggccaagcg gaaggtctcc       960
     atctggttcc gggcgcgcgg cacctccaag tgggtccgca aggccgtcgt gacgaccaac      1020
     ggcaagggcc ggttccgccg gaagttcatc gcccggaagg gcggctactg gcgcgccaag      1080
     ttcgccggcg gccccaagtt cttcggcgtc accagcggca gcgactacgt cgacgtccgc      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page