(data stored in ACNUC30630 zone)

EMBL: CP001738.PE551

CP001738.PE551       Location/Qualifiers
FT   CDS_pept        complement(631901..632512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0564"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_5545
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96160"
FT                   /db_xref="GOA:D1A3N5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3N5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY96160.1"
FT                   /translation="MGETASKSRLRAPARRATIIEAALKVFAGKGYHAASLGEIAKVAG
FT                   VARTVLYDHFPSKRVLLLAVMQEQNAALMEYVGARITGSGTPEERMRSTIDAFFSFAQS
FT                   RPEARKLLFGQADEADPEISTVRRGIRESHAQVVTALLANDMRAVGVDPKEPIAEAMVE
FT                   LLIAGLDGVAQWWERHPEMPRSMLVEGAMRLLWTGLGNVR"
     atgggggaaa ccgcgtccaa gtcgcggctg cgcgcgccgg cccgccgggc gacgatcatc        60
     gaggcggcgc tgaaggtctt cgccggcaag ggctaccacg ccgcctcgct gggggagatc       120
     gccaaagtgg ccggggtggc gcggacggtg ctgtatgacc acttcccctc caagcgggtg       180
     ctgctgctgg cggtcatgca ggagcagaac gcggcgctga tggagtacgt gggcgcccgc       240
     atcaccggct caggcacccc cgaagagcgg atgcgctcga cgatcgatgc gttcttcagc       300
     ttcgcgcaaa gccgtccaga ggctcgcaag ctgctgttcg gccaggcgga cgaggccgat       360
     ccggagatca gcaccgtccg gcgcggcatc cgcgaatcgc acgcacaggt ggtcacggcg       420
     ctgctggcca acgacatgcg cgcagtcggc gtggacccca aagagccgat cgccgaggcg       480
     atggtggaac tcctcatcgc cggtctggac ggggtggcgc agtggtggga gcgccacccg       540
     gagatgccca gatcgatgct ggtggagggc gcgatgcgac tgttgtggac cgggctgggc       600
     aacgtccgct ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page