(data stored in ACNUC30630 zone)

EMBL: CP001738.PE557

CP001738.PE557       Location/Qualifiers
FT   CDS_pept        641842..642417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce5972 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96166"
FT                   /db_xref="InterPro:IPR018700"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P1"
FT                   /inference="similar to AA sequence:KEGG:sce5972"
FT                   /protein_id="ACY96166.1"
FT                   /translation="MSQADPGIDGGALISTLKRAAGVLRDAGVEFALAGGFAAYVRGAA
FT                   ISTHDVDFVLREQDVDAAVSALTAAGMRHRECPEEWLTKVYDGDRPIDLIFRPSGRPVD
FT                   GGMLQRAEELPVAAVSMPVLPADDLVIMRLLAFTETACDFSDFLHVCRALREQVDWPKV
FT                   AKETAHSPYAYAFLTLLHRLDVIEGGFL"
     atgtctcagg cggatccggg gatcgacggc ggcgccctga tctccaccct gaagcgggcg        60
     gcgggcgtgc tgcgggacgc gggagtggag ttcgcactgg ccggcgggtt cgccgcctac       120
     gtgcggggcg cggcgatctc cacccacgac gtcgacttcg tgctgcgcga gcaggacgtg       180
     gacgccgcgg tgagcgcgct gaccgccgcc gggatgcgtc accgggagtg cccggaggag       240
     tggctcacca aggtctacga cggcgaccgg cccatcgact tgatcttccg gccgtccggg       300
     cgcccggtgg acggcgggat gctgcagcgg gccgaggagc tgccggtggc ggcggtgagc       360
     atgccggtgc tgcccgccga cgacctggtg atcatgcggc tgctggcgtt caccgagacg       420
     gcctgcgact tcagcgactt cctgcacgtg tgccgggcgc tgcgcgagca ggtggactgg       480
     ccgaaagtgg ccaaggagac cgcgcactcc ccgtacgcct acgccttctt gacgctgctg       540
     caccggctgg acgtgatcga ggggggattc ctgtga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page