(data stored in ACNUC30630 zone)

EMBL: CP001738.PE560

CP001738.PE560       Location/Qualifiers
FT   CDS_pept        643479..643676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96169"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96169.1"
FT                   /translation="MTDKQQPDRSKSLADRRAEAGAPVDSGDEPDLAGEWEPGPTDPPN
FT                   AEAETPGGEAEGYSPQTRIP"
     atgaccgata aacagcagcc cgatcgttcc aagtccctgg ccgaccgccg ggccgaggcc        60
     ggcgccccgg tcgattccgg cgacgaaccc gacctggccg gcgagtggga gcccggcccc       120
     accgacccgc ccaacgccga ggccgaaacc ccgggcggcg aggcggaggg gtactctccg       180
     cagacccgca tcccctga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page