(data stored in ACNUC30630 zone)

EMBL: CP001738.PE561

CP001738.PE561       Location/Qualifiers
FT   CDS_pept        complement(643691..644539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0575"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: eba:ebA6991 putative oxidoreductase
FT                   (related to short-chain alcohol dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96170"
FT                   /db_xref="GOA:D1A3P5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY96170.1"
FT                   /translation="MSEQPAQTQPYPGRTPDMTPKPRDEMRDYRGRGLLAGRRALITGG
FT                   DSGIGRAVSVAFAKEGADVALAYLSEDADARRTAELVEREGRRCLTLGGDLAAAGHCRR
FT                   VVAHAARELGGLDVLVLHHGTQRPVEDVRQIDQEHLRRTFEVNVFSLLWIVQAALEHLG
FT                   EGSSIIVTGSINGLRGNKTLIDYAASKAAAMNLVQSLAQTLMDKGIRVNCVAPGPVWTP
FT                   LIPATFPKERVEGFGRQAPMGRAADPDEIAPSYVFFASDRMSSYYTGQTLVPAGGEIHP
FT                   G"
     atgagcgaac aaccggcaca gacccagccc taccccggac gcaccccgga tatgacacct        60
     aagccccggg acgagatgcg cgactaccgc ggccgcggcc tgctcgccgg caggcgcgcc       120
     ctgatcaccg gcggcgactc cggcatcggc cgggccgtct cggtcgcctt cgccaaggag       180
     ggcgccgacg tggcgctggc ctacctgtcg gaggacgccg acgcccgccg caccgccgag       240
     ctggtcgagc gggagggccg ccgctgcctc accctgggcg gcgacctggc cgcagcaggc       300
     cactgccgcc gcgtcgtcgc gcacgccgcc cgcgagctgg gcgggctgga cgtcctggtg       360
     ctgcaccacg gcacccagcg cccggtggag gacgtccggc agatcgatca agagcacctg       420
     cggcggacct tcgaggtcaa cgtgttcagc ctgctgtgga tcgtgcaggc ggcgctggag       480
     cacctgggcg aaggctcgtc catcatcgtc accggctcca tcaacgggct gcgcggcaac       540
     aagacgctca tcgactacgc cgcctccaag gccgccgcga tgaacctggt gcagtccctg       600
     gcccagaccc tcatggacaa gggcatccgg gtcaactgcg tcgcccccgg cccggtgtgg       660
     accccgctca tccccgcgac cttcccgaaa gagcgcgtgg agggcttcgg ccggcaggcg       720
     cccatgggcc gtgccgccga ccccgatgag atcgccccgt cctatgtctt cttcgccagc       780
     gaccgcatgt cgtcctacta caccggccag accctggtcc cggccggcgg cgagatccac       840
     ccggggtaa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page