(data stored in ACNUC30630 zone)

EMBL: CP001738.PE562

CP001738.PE562       Location/Qualifiers
FT   CDS_pept        644728..645501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0576"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bur:Bcep18194_A5880 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96171"
FT                   /db_xref="GOA:D1A3P6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY96171.1"
FT                   /translation="MDLNGVSAVISGGASGLGEATARDLAAHGVKVVIADLNEAKGKAL
FT                   ADEIGGVFVKTDVSDEAQVQAAVQAAVDTGAPLRIIVNSAGIGWASRTVNRDGSPHDLA
FT                   SFQKVIQVNLVGTFNLMRIGAAAIAKTEPADADGLRGVVINTASVAALEGQTGQVAYSA
FT                   SKGGIVGMTLPAARDLSAIGVRVNTICPGIIDTPIYGEGEAAEAFKAKLIAPVVFPKRM
FT                   GKAAEFAHLVRALIENDYMNGEVIRFDGGIRFQPK"
     atggacctga acggagtctc cgccgtcatc tccgggggcg ccagcggcct cggtgaggcc        60
     accgcccgcg acctggccgc ccacggcgtc aaggttgtca tcgccgacct gaacgaggcc       120
     aagggcaagg cgctggccga cgagatcggc ggcgtgttcg tcaagaccga cgtctccgac       180
     gaggcacagg tgcaggccgc cgtccaggcc gccgtggaca ccggcgcccc gctgcggatc       240
     atcgtcaaca gcgccggcat cggctgggcc agccgcaccg tcaaccgtga cggcagcccg       300
     cacgacctgg cctccttcca gaaggtcatc caggtcaacc tggtcggcac cttcaacctg       360
     atgcggatcg gcgccgccgc catcgccaag accgagcccg ccgacgccga cggcctgcgc       420
     ggcgtggtga tcaacaccgc ctccgtggcg gccctggagg gccagaccgg tcaggtcgcc       480
     tactcggcct ccaagggcgg catcgtcggc atgacgttgc cggccgcccg tgacctgtcg       540
     gcgatcggcg tccgcgtcaa caccatctgc ccgggcatca tcgacacccc gatctacggc       600
     gagggcgagg ccgccgaggc gttcaaggcc aagctgatcg cgccggtggt gttccccaag       660
     cggatgggca aggccgccga gttcgcccac ctggtgcggg ccctcatcga gaacgactac       720
     atgaacggtg aggtcatccg cttcgacggc ggcatccgct tccagcccaa gtga             774
//

If you have problems or comments...

PBIL Back to PBIL home page