(data stored in ACNUC30630 zone)

EMBL: CP001738.PE563

CP001738.PE563       Location/Qualifiers
FT   CDS_pept        645519..646283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0577"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   reh:H16_A1889 enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96172"
FT                   /db_xref="GOA:D1A3P7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D1A3P7"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACY96172.1"
FT                   /translation="MSDAVLTETEGAVLVITINRPEAKNAVNAAVAEGIAAAIDEFEGR
FT                   KDLSVAVLTGAGGTFCSGMDLKGFLKGEAPWAAGRGFGGIVEKPPVKPIIAAVEGYALA
FT                   GGCEIALSCDMIVASREAKFGLPEPKRGLVAAAGGLMRLPRRIPYHIAMEIALTGDFYG
FT                   AERMAELGFVNRLTEPGGALAAAKELALKIGENAPLALAATKRIIVESPYWSAEEMWQR
FT                   QNEISGPVFASKDAQEGPKAFAEKRKPQWTGE"
     atgtccgatg cagttctgac cgagaccgag ggtgcggtcc tggtcatcac catcaaccgg        60
     cccgaggcca agaacgcggt gaacgccgcc gtggcggagg gcatcgccgc cgccatcgat       120
     gagttcgagg gccgcaagga cctgtcggtc gcggtcctca ccggcgccgg cggcaccttc       180
     tgctccggca tggacctcaa gggcttcctc aagggcgagg ccccgtgggc cgcgggccgc       240
     ggcttcggcg gcatcgtgga aaagcccccg gtcaagccga tcatcgccgc ggtcgagggc       300
     tacgcgctgg ccggcggctg tgagatcgcg ctgtcctgcg acatgatcgt cgcctcccgg       360
     gaggccaagt tcggcctgcc cgagcccaag cgcggcctgg tggcggcggc cggcggcctg       420
     atgcggctgc cgcggcgcat cccctaccac atcgccatgg agatcgccct gaccggcgac       480
     ttctacggcg ccgagcgcat ggccgagctc ggcttcgtca accggctcac cgagccgggc       540
     ggcgcgctgg ccgcggccaa ggagctggcg ctgaagatcg gcgagaacgc cccgctggcc       600
     ctggcggcca ccaagcggat catcgtcgag tcgccgtact ggtcggccga ggagatgtgg       660
     cagcgccaga acgagatctc cggcccggtc ttcgcctcca aggacgccca ggagggcccg       720
     aaggccttcg ccgagaagcg caagccgcag tggacgggcg agtga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page