(data stored in ACNUC30630 zone)

EMBL: CP001738.PE573

CP001738.PE573       Location/Qualifiers
FT   CDS_pept        658344..658526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96182"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4E7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96182.1"
FT                   /translation="MRQQIDLRVHDRVALDEIELYSEILSAVATAERPLTIDEIDTVLG
FT                   VRREDGTGRRESTPQ"
     gtgcgacagc agatcgacct gcgcgtccac gaccgtgtcg cgctggacga gatcgaactc        60
     tactccgaga tcctgagcgc ggtggccacg gccgaacggc cgctgaccat cgacgagatc       120
     gacacggtgc tcggggttcg gcgtgaggac gggaccggtc gtcgtgagtc gacgccacag       180
     tag                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page