(data stored in ACNUC30630 zone)

EMBL: CP001738.PE575

CP001738.PE575       Location/Qualifiers
FT   CDS_pept        659665..660822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0589"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: dds:Ddes_1960
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96184"
FT                   /db_xref="GOA:D1A4E9"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4E9"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ACY96184.1"
FT                   /translation="MTEARETVLNPPPPPGDEPPPLSEQASRVSIKAWLGLLALVLVVI
FT                   GAGALGLRSDAQTAVLVLVVVIALGFDYTNGFHDAANAIATSVSTRALTPRAALLMAAV
FT                   MNLLGALLGVEVAKTVSEVITPPEGLHGLTVVAAGVLGAITWNMITWYFGLPSSSSHAL
FT                   IGGVVGAGLASASSVSWGTVVDKVAIPMVVSPVVGFCLAYLVMVAILWIFRRAHPRKIG
FT                   RRFRIAQSLSAASMALGHGLQDAQKTMGIIVLALVTTGHADGQSVPLWVIVACASALAA
FT                   GTYAGGWRIMRTLGRRVIELDPPKGFAAEATASAILYATAYIWHAPISTTHTITSCIMG
FT                   VGATKRLSAVRWGVAGNIVMAWVLTMPMAALVAGVVYWFVHLFGA"
     atgaccgagg cgcgtgagac cgtcctgaac cccccgcccc cgcccgggga cgagccgccc        60
     ccgctcagcg agcaggcctc ccgggtatcg atcaaggcct ggctggggct gctggcgctg       120
     gtgctggtgg tgatcggcgc cggagcgctc gggctgcgct cagacgccca gaccgcggtg       180
     ctggtgctgg tcgtcgtgat cgccctgggc ttcgactaca ccaacggctt ccacgacgcc       240
     gccaacgcca tcgccacctc ggtgtccacc cgggcgctga ccccgcgcgc cgcgctgctg       300
     atggccgcgg tgatgaacct gctgggcgcg ctgctggggg tggaggtcgc caagaccgtc       360
     agcgaggtga tcaccccgcc ggaagggctg cacgggctga ccgtggtggc cgccggggtg       420
     ctcggcgcca tcacctggaa catgatcacc tggtacttcg ggctgccgtc gtcgtcctcg       480
     cacgccctga tcggcggcgt ggtgggcgcg ggactggcct cggcctcatc ggtgagctgg       540
     gggacggtcg tcgacaaggt cgccatcccg atggtggtct ccccggtcgt cggcttctgc       600
     ctggcctacc tggtgatggt ggccatcttg tggatcttcc gccgggcgca cccgcgcaag       660
     atcggccgcc ggttccgcat cgcccagtcg ctgtcggcgg cgtccatggc gctggggcac       720
     ggcctgcagg acgcccagaa gaccatgggc atcatcgtgc tggcgctggt gaccaccggg       780
     cacgccgacg gccagagcgt gccgctgtgg gtgatcgtgg cgtgcgcgag cgcgctggcc       840
     gccggcacct atgcgggcgg gtggcggatc atgcgcaccc tgggccgccg ggtgatcgaa       900
     ctggatccgc ccaagggttt cgccgccgaa gcgacggcct cggcgatcct gtacgccacc       960
     gcctacatct ggcacgctcc aatctccacc acccacacga tcacctcctg catcatgggc      1020
     gtcggcgcca ccaagcggct gtcggccgtc cgctggggcg tggcgggcaa catcgtgatg      1080
     gcctgggtgc tgaccatgcc gatggcggcg ctggtggccg gcgtcgtcta ctggttcgtc      1140
     cacctgttcg gggcatag                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page