(data stored in ACNUC30630 zone)

EMBL: CP001738.PE579

CP001738.PE579       Location/Qualifiers
FT   CDS_pept        complement(663713..664819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0593"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: sml:Smlt1552
FT                   putative phosphate transport system, substrate-binding
FT                   exported periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96188"
FT                   /db_xref="GOA:D1A4F3"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4F3"
FT                   /inference="protein motif:TFAM:TIGR00975"
FT                   /protein_id="ACY96188.1"
FT                   /translation="MKNGSRLAALGGVVVAGALALSACGSDDNVGAGASNAPTGKIDCV
FT                   KGTVNAAGASSQKNAIEEWKKIYAQQCAGATLNYNPAGSGAGIQAFLAGQVAFAGSDSA
FT                   LDEQEAARARQRCQGNPAWNLPMVVGPVAVIYNLPGVDGLQLKPKTLAAIFAGKLKKWN
FT                   DPAIAADNPGTDLPDTDIKPIHRSDESGTTENFTDYLSNVAGDEWKWEPEKKWPTEAGG
FT                   QGAPKSDGVVTVLKQTEGGISYVEMSFAKKNGLQTAKIANGSGEYVEVSEQSVGNALDS
FT                   AEIVGQGHDLALKLDYNTSAAGAYPIFLVTYEVVCSKGLPADQAAFVKAFLKYTAGEDG
FT                   QKVLTDAGYAPLSPALAAKVRAAVEALS"
     gtgaagaacg gctctcgact cgccgccctc ggtggcgtgg tcgttgcggg cgcgctggcg        60
     ctgtcggcct gtggttccga cgacaacgtc ggggccggcg cgtccaacgc gccgaccggc       120
     aagatcgact gcgtcaaggg cacggtgaac gccgccggcg ccagctcgca gaagaacgcc       180
     atcgaggagt ggaagaagat ctacgcccag cagtgcgcgg gcgccaccct caactacaac       240
     cccgccggtt cgggtgccgg catccaggcg ttcctggccg gccaggtggc cttcgcgggc       300
     tcggactcgg cactggatga gcaggaggcc gcccgggcgc ggcagcgctg ccagggcaac       360
     ccggcctgga acctgcccat ggtggtcggc ccggtcgcgg tgatctacaa cctgcccggc       420
     gtggacggcc tgcagctgaa gccgaagacg ctggcggcga tcttcgccgg caagctcaaa       480
     aagtggaacg atccggcgat cgccgccgac aaccccggca ccgacctgcc ggacaccgac       540
     atcaagccga tccaccgctc cgacgagtcg ggcaccaccg agaacttcac cgactacctg       600
     agcaacgtcg caggtgacga gtggaagtgg gagccggaga agaagtggcc gaccgaggcc       660
     ggcggccagg gggcgcccaa gtccgacggc gtggtgaccg tcctgaagca gaccgagggc       720
     ggcatctcgt acgtggagat gtccttcgcc aagaagaacg gcctgcagac cgccaagatc       780
     gccaacggct cgggcgagta cgtggaggtc tccgagcaga gcgtgggcaa cgccctcgac       840
     agcgccgaga tcgtcggcca gggccatgac ctggcgctga agctggacta caacaccagt       900
     gccgccggcg cctacccgat cttcctggtc acctacgagg tggtctgctc caagggcctg       960
     ccggccgacc aggccgcgtt cgtcaaggcc ttcctgaagt acaccgccgg cgaggacggc      1020
     cagaaggtgc tcaccgacgc cggttacgca ccgctgtcgc ccgccctggc ggccaaggtc      1080
     cgcgcagccg tcgaggccct gtcctga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page