(data stored in ACNUC30630 zone)

EMBL: CP001738.PE581

CP001738.PE581       Location/Qualifiers
FT   CDS_pept        complement(665993..666706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0595"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: slo:Shew_3419 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96190"
FT                   /db_xref="GOA:D1A4F5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4F5"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ACY96190.1"
FT                   /translation="MSSLLLLTNALEPSDEVLPALGLLLHSVRVAPAEASALIDAPPAD
FT                   VVLVDARRDLVQAKSLCRLLRTTGLDCPLLAVVTEGGLAALSPEWGLDDVLLQTAGPAE
FT                   VEARLRLAIGRAAASEADDVPGEIRNGDLTIDEATYTARLRGRVLDLTFKEFELLKYLA
FT                   QHPGRVFTRAQLLQEVWGYDYFGGTRTVDVHVRRLRAKLGAEYESLIGTVRNVGYRFVP
FT                   DHRPGESETREPVRS"
     ttgagcagtt tgctcttgct caccaacgca ctggaacctt ccgatgaggt gctccccgcg        60
     ttggggttgc tgttgcactc agtacgcgtc gctcctgcgg aggcatccgc actgatcgac       120
     gccccaccgg ccgatgtggt gctggtcgac gcccgccgcg acctggtgca ggccaagagc       180
     ctgtgccggc tgctgcggac caccgggctg gactgcccac tgctggccgt cgtcaccgaa       240
     ggaggtctgg ccgcgctcag ccccgagtgg gggctggacg acgtgctgct gcagaccgcg       300
     ggacccgccg aggtcgaggc ccggttgcgg ctggccatcg gcagagcggc cgcgagcgag       360
     gccgacgatg tgccgggcga gatccgcaac ggcgacctga ccatcgacga ggcgacctac       420
     accgcgcggc tgcgcggccg ggtgctggac ctgaccttca aggaattcga gctgctgaag       480
     tacctggcgc agcatccggg acgggtgttc acccgcgccc agctgctgca ggaggtgtgg       540
     gggtatgact acttcggcgg cacccggacc gtggacgtgc acgtgcggcg gctgcgggcc       600
     aagctcggcg ccgagtacga gtcgctgatc ggcacggtcc gcaacgtcgg ctaccggttc       660
     gtcccggacc accggccggg cgaatcggag acccgggagc ccgtgcgttc ttga             714
//

If you have problems or comments...

PBIL Back to PBIL home page