(data stored in ACNUC30630 zone)

EMBL: CP001738.PE582

CP001738.PE582       Location/Qualifiers
FT   CDS_pept        666855..667109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0596"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96191"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4F6"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ACY96191.1"
FT                   /translation="MARGTIRYWAAARAAAGVEEEPYEAATLAEALHNARRGRSGDFAR
FT                   VLERSSFLIDGAPVGTRPHEGVALAEGAVIEVLPPFAGG"
     atggcgaggg gcaccatcag gtactgggcg gcggcgcgcg ccgccgcggg ggtcgaggaa        60
     gagccctatg aggccgcgac gctggccgag gcgctgcaca acgcccggcg cggccggagc       120
     ggcgacttcg cccgggtgct cgagcgcagc tcattcctga tcgacggcgc cccggtcggc       180
     acccgcccgc acgagggcgt cgccctggcc gagggcgccg tgatcgaggt gctgccgccg       240
     ttcgcgggtg gctga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page