(data stored in ACNUC30630 zone)

EMBL: CP001738.PE583

CP001738.PE583       Location/Qualifiers
FT   CDS_pept        667333..668031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96192"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4F7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY96192.1"
FT                   /translation="MRKALVVFLVLLAGGLIAADRIGVLLVQREVAERLAVQYSLPQRP
FT                   EVTIHGLPFLTQAIGGEYRQVDVAIGDFTRQEVTLRDVRVRIENLRAPLSEAINGDTSG
FT                   VVAGTATASAILPYDLIKRHAPANVTRIGASGSDLEVELTGSLLGFTLNGTAVLSAEVS
FT                   RDGIRITPRSVATQGLRVPLGALRGPLSWTVPVPELPLGSRISRVEITEAGIRVGATAH
FT                   DVAVGELAGR"
     atgcgcaagg ctctggtcgt gttcctcgtc ctgctggcgg gcgggctgat cgcggcggac        60
     cgcatcggcg tgctgctggt gcagcgggaa gtggccgagc ggctggccgt ccagtactcc       120
     ctgccccagc ggccggaggt caccatccac gggctgccct tcctcaccca ggccatcggg       180
     ggcgagtacc ggcaggtcga cgtggcgatc ggcgacttca cccggcagga ggtcacgctg       240
     cgggacgtgc gggtgcgcat cgagaacctg cgggcgccgc tgtcggaggc gatcaacggc       300
     gacaccagcg gggtggtggc gggcaccgcg accgcctcgg cgatcctgcc ctacgacctg       360
     atcaagcgcc acgcccccgc caacgtcacc cggatcgggg ccagcggctc ggacctggag       420
     gtggagctga ccggctcgct gctcggcttc accctcaacg gcaccgccgt gctgtcggcc       480
     gaggtctccc gcgacggcat ccggatcacc ccgcgctccg tcgccacgca gggcctgcgg       540
     gtcccgctgg gcgcgctgcg cggaccgctg tcatggacgg tgccggtgcc ggagctgccg       600
     ctgggctcgc gcatcagccg cgtcgagatc accgaggccg gcatccgcgt cggcgccacc       660
     gcccacgacg tggccgtggg agagctcgcc ggccggtga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page