(data stored in ACNUC30630 zone)

EMBL: CP001738.PE584

CP001738.PE584       Location/Qualifiers
FT   CDS_pept        668065..668622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0598"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   afw:Anae109_0250 RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96193"
FT                   /db_xref="GOA:D1A4F8"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4F8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACY96193.1"
FT                   /translation="MTAGEPDREGVRVTGVGPTADERLLRSLYAEHGGPLLGYALRLTG
FT                   GDRQQAEDIVQETLLRAWRHPEALTGRPVRPWLFTVARNLAVDAHRARRSRPPETGLHE
FT                   YAALPAGNDDIDRALESWTVAEALADLSPQHRAVILETYYRGRSVAEAAQVLGIPPGTV
FT                   KSRTYYALRALKLALEERGLAP"
     ttgaccgccg gtgaaccgga ccgggagggc gtacgtgtca ccggcgtggg acccaccgcc        60
     gacgaacggt tgctgcgctc gctgtacgcc gagcacggcg gtccgctgct cggatacgcc       120
     ctgcggctga ccggcgggga tcgccagcag gccgaggaca tagtgcagga gaccctgctg       180
     cgggcctggc ggcacccgga ggccctcacc ggccggccgg tccgcccctg gctgttcacc       240
     gtggcgcgca acctcgcggt ggacgcccac cgggcccggc ggtccagacc gccggagacc       300
     gggctgcacg agtacgccgc gctgcctgcc gggaacgacg acatcgaccg ggccctggag       360
     tcctggacgg tggccgaggc actggccgac ctgagcccgc agcaccgcgc agtgatcctg       420
     gagacctact accggggccg ttcggtggcc gaggccgccc aggtgctggg catccccccg       480
     ggcaccgtga aatcgcgaac ctactacgcg ctgcgcgcgc tgaagctcgc cttggaggag       540
     cgggggttgg cgccatga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page