(data stored in ACNUC30630 zone)

EMBL: CP001738.PE59

CP001738.PE59        Location/Qualifiers
FT   CDS_pept        61640..62218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0060"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: hch:HCH_00090 sortase (surface
FT                   protein transpeptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95668"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADF8"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ACY95668.1"
FT                   /translation="MTYQLWGTDRYTRQQQDRLNKELLRSWNAPDEKITTEKVKLGGGL
FT                   ALLRIPRLGSKYRYVIVEGVEPEDLRKGPGHYPGSAMPGQIGNFVVSGHRTTYSAPFNR
FT                   IDQLRRGDRILIDTRRKQYVYKVTGHRIVKPTAVEVTAPVPFHPGRKPTKSLITLTTCH
FT                   PKYSDAKRLIVFGELAEQRSRRVAAPAGR"
     gtgacctacc agctgtgggg caccgaccgg tacacccgcc agcagcagga ccggctcaac        60
     aaggagctgc tgcggtcctg gaacgccccc gacgagaaga tcaccaccga gaaggtcaag       120
     ctcggcggcg ggctggcact gctgcgcatc ccccggctgg ggagcaagta ccggtatgtg       180
     atcgtcgagg gcgtcgaacc cgaggacctg cgcaagggcc ccggccacta cccgggcagc       240
     gcgatgcccg gccagatcgg caacttcgtg gtctccggcc accgcaccac ctactcggcc       300
     cccttcaacc gcatcgacca gctgcgccgc ggcgaccgca tcctcatcga cacccgccgc       360
     aagcagtacg tctacaaggt caccggccac cgcatcgtca agcccaccgc cgtcgaggtg       420
     accgcgcccg tgccgttcca ccccggccgc aagcccacca aatcgctgat cactctcacc       480
     acgtgccatc ccaagtactc cgacgccaag cgcctcatcg tcttcgggga actggccgag       540
     cagcgttccc gccgggtcgc ggccccggcc gggcggtaa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page