(data stored in ACNUC30630 zone)

EMBL: CP001738.PE595

CP001738.PE595       Location/Qualifiers
FT   CDS_pept        681251..682654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0609"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACY96204"
FT                   /db_xref="GOA:D1A4G9"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="InterPro:IPR042485"
FT                   /db_xref="UniProtKB/TrEMBL:D1A4G9"
FT                   /inference="protein motif:PFAM:PF05108"
FT                   /protein_id="ACY96204.1"
FT                   /translation="MQTRKDLLQAHRLMTQRAALALILGQPDTAEAPMRRLNVAAFSGV
FT                   MITVVVMAIFGIVGILRPGGAKRLQEPGTLIIEKETGARYVWCQDPPKLCPVANYVSAR
FT                   LLAGQDAGKRRTVSRNSLRNFQRGPLIGIPEAPNTLPEAKHLVKTPWSACVRTVELPTR
FT                   GRTSLATMVVGTPVGGQSLRDDQGLVIRSAGQTWLIWKNQRLRIPEELVPALAPNPARV
FT                   TPKWLNALPPGPDYKAPSIPNLGQEVPGPEGGKARVGQFYAVETGSTTTWYVQLADGLA
FT                   PISEIEKELLRADPAISQKAYSGRPAQEIALPPYVLNSMQRSSRRISKQELQGAPPTII
FT                   PYADSTPLCVIYDDPTGERRGYVTLNGRLPDPPQSTTPFGVDQLVFPPGGAALVGSMPA
FT                   PGKGSEVNSYSLVAEGRRYQLESPEVAELLGYEISQAVPVPSAVLNLIPTGPTLDPDAA
FT                   SQQLTGGPR"
     gtgcagaccc gcaaggacct gctgcaggcc caccggctga tgacccagcg ggcggcgctg        60
     gcgctgatcc tcggccagcc cgacaccgcc gaggcaccga tgcgccggct caacgtcgcc       120
     gccttcagcg gggtcatgat caccgtggtg gtgatggcca tcttcggcat cgtcggcatc       180
     ctgcgccccg gcggggccaa gcggctgcag gagcccggca cgctgatcat cgagaaggag       240
     accggcgccc gctacgtgtg gtgccaggac ccgccgaagc tgtgcccggt cgccaactac       300
     gtctccgcgc ggctgctggc cggccaggac gcggggaagc ggcggacggt ctcgcgcaac       360
     tcgctgcgga acttccagcg cggccccctg atcggcatcc cggaagcccc caacaccctg       420
     cctgaggcca agcacctggt gaaaacgccg tggtcggcgt gcgtccgcac ggtcgagctg       480
     cccacccgcg gccgcacctc gctggccacc atggtggtgg gcaccccggt cggcgggcag       540
     tcgctgcgcg atgaccaggg gctggtcatt cgctccgccg gccagacctg gctgatctgg       600
     aagaaccagc gcctgcgcat cccagaagag ctggtgcccg ccctggcccc caaccccgcc       660
     agggtcaccc ccaagtggct caacgcgctg ccgcccggcc ccgactacaa ggcgccctcg       720
     atcccgaacc tgggccagga ggtgcccggg ccggaaggcg gcaaggccag ggtcggccag       780
     ttctacgccg tcgagaccgg ctccaccacc acctggtacg tgcagctggc cgacggcctg       840
     gcccccatca gcgagatcga aaaggagctg ctgcgggccg atccggccat ctcccagaag       900
     gcctacagcg gccgcccggc ccaggagatc gcgctcccgc cgtacgtgct gaactcgatg       960
     cagaggtcgt cccggcggat ctccaagcag gagctgcagg gcgcgccacc gacgatcatt      1020
     ccctatgcgg acagcacgcc gctgtgcgtg atctacgacg atcccaccgg tgagcgccgc      1080
     ggttatgtga cgctgaacgg ccggttgccg gacccgccgc aaagcaccac cccgttcggg      1140
     gtggaccagc tggtgttccc gcccggcggg gcggccctgg tcggttcgat gcccgccccc      1200
     ggaaaaggaa gcgaggtgaa ctcgtattcc ctggtggcag agggacggcg ctatcaactg      1260
     gagtctcctg aggtcgctga gctactcggt tacgagatct cccaggcggt gccggtgccg      1320
     tccgctgtgc tgaatctcat tcccaccggc ccgacgttgg atcccgacgc ggcgtcacag      1380
     cagctcaccg gcggtccgcg ttaa                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page