(data stored in ACNUC30630 zone)

EMBL: CP001738.PE61

CP001738.PE61        Location/Qualifiers
FT   CDS_pept        62442..63035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0062"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   cak:Caul_2776 anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95670"
FT                   /db_xref="GOA:D1ADG0"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADG0"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACY95670.1"
FT                   /translation="MSADGPRVLVVDNHDSFVFNIVQYLLELGADCVVKDRSDVTVDDA
FT                   AGVHGVLLSPGPGHPADTGVCLELVKDAERRRLPLLGVCLGHQIIGHVYGAAVHRAPEL
FT                   VHGYTSPIEHDGEGVLAGLPSPFQATRYHSLAVDPASVPRALKVTARTPDGVVMGLRHR
FT                   DRPIEGVQFHPESVLSECGHRLLANWLATCAFVP"
     atgagcgctg acggcccccg cgtgctggtc gtggacaatc acgacagctt cgtgttcaac        60
     atcgtccagt acctgctgga actgggcgcc gactgcgtgg tcaaggaccg ctcggatgtg       120
     acggtggacg acgccgccgg cgtgcacggc gtgctgctga gccccggccc cggccatccc       180
     gccgacaccg gcgtctgcct ggaactggtg aaggacgccg agcggcggcg cctgccgctg       240
     ctgggggtct gcctggggca ccagatcatc ggccatgtct acggggccgc ggtccatcgg       300
     gcgcccgaac tcgtccacgg ctacaccagc cccatcgagc acgacggcga aggggtcctg       360
     gcgggcctgc cgagcccgtt ccaggccacc cgctaccact cgctggcggt ggacccggcc       420
     tccgtccccc gcgccctgaa ggtcaccgca cgcacccccg acggggtggt catgggactg       480
     cgccaccgcg accgccccat cgagggcgtg cagttccacc cggagtccgt gctgtccgaa       540
     tgcggccacc gcctgctggc caactggctc gccacctgcg ctttcgtgcc ctga             594
//

If you have problems or comments...

PBIL Back to PBIL home page