(data stored in ACNUC30630 zone)

EMBL: CP001738.PE63

CP001738.PE63        Location/Qualifiers
FT   CDS_pept        complement(65148..66764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0064"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: scl:sce7721 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95672"
FT                   /db_xref="GOA:D1ADG2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADG2"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY95672.1"
FT                   /translation="MTTADLVLDSRYRLLRRLATGGMGEVWEASDELLSRPVAVKLLRQ
FT                   EHVGNEQARARFRAEARYAAALQHSGIAQVYDYGEHDDLAYLVMELVSGESLSRILARQ
FT                   GALGVETTLDVVAQAARALQVAHSAGIIHRDVKPGNLMMTPSGVVKITDFGIARGLNVA
FT                   TLTQTGMVMGTAHYVSPEQASGQPITFATDLYSLGVVAYECLTGRPPFDAEQPVAIALK
FT                   HVREAPPELPEEIPEAVRTLVRVLLAKNPEDRPPSAQAVADEAFRIHDALQAGEPVESS
FT                   FRDLLAGSGASLPAHRFGDPFDDAFDDGYGDVRDGTSEVARTRLLDEAAGMEPATVRGS
FT                   AVDALRPSGGLATWSELEDGETADTLTGVHPAGFSAAAGSRVAFAGTKVRVQRRTVVAI
FT                   ASVTAGVLALGAVAAGSLSRGPSAGIEETRDRVPSVVPEPSSLVPSRVPSPTGTPSLPA
FT                   WPGPRPPGNNFTASTTPTPSASSTGRPRPSPTTGSPTPQGPSPTPSESGNSPDPSPPVE
FT                   PPPEPEPEPEEPTTGDGLGSE"
     gtgaccacgg ccgacctcgt cctggactcc cggtaccggc tgctgcggcg gctggccacc        60
     ggaggcatgg gcgaggtctg ggaggccagc gacgagctgc tcagccgtcc cgtcgcggtt       120
     aagctgctgc gccaggaaca tgtgggcaac gagcaggcgc gggcccggtt ccgcgccgag       180
     gcccgctatg cggcggccct ccagcacagc ggcatcgccc aggtctacga ctacggcgag       240
     cacgacgacc tggcctacct ggtgatggag ctggtgtcgg gggagtcgct gtcgcggatc       300
     ctggcccgcc agggcgcgct gggggtggag accaccctgg acgtggtggc ccaggcggcc       360
     cgggcgctgc aggtggccca cagcgccggg atcatccacc gcgacgtcaa gcccggcaac       420
     ctgatgatga ccccgagcgg ggtcgtgaag atcaccgact tcggcatcgc ccgcggcctc       480
     aacgtcgcca ccctcaccca gaccggcatg gtgatgggca ccgctcacta cgtctctccc       540
     gagcaggcct cgggccagcc catcaccttc gccaccgacc tgtactccct gggggtggtg       600
     gcgtacgaat gcctgaccgg gcggccgccc ttcgacgccg agcagccggt cgccatcgcc       660
     ctcaagcatg tgcgggaggc gcctccggag ctgccggagg agatcccgga ggcggtgcgg       720
     acgctggtgc gcgtcctgct ggccaagaat ccggaggacc ggccgcccag cgcccaggcc       780
     gtggcggacg aggcgttccg gatccacgat gcgctgcagg ccggcgagcc ggtggaaagc       840
     tcgtttcgcg acctgctcgc gggctccggc gcgtccttgc ccgcccaccg cttcggcgac       900
     ccgttcgatg acgcgttcga cgacggctac ggcgacgtcc gtgacggaac gtccgaagtg       960
     gcgcgcaccc gcctgctgga cgaggcggcc ggcatggaac cggccaccgt ccggggatcc      1020
     gccgtggacg cgctgcggcc gagcggcggc ctggccacgt ggtcggagtt ggaggacggg      1080
     gagacggcgg ataccctcac gggagtgcac ccggcgggct tctccgccgc cgcgggatcc      1140
     cgggtcgcgt tcgcgggcac gaaggtgagg gtgcaacggc gcaccgtggt ggcgatcgcc      1200
     tcggtgaccg ccggggtgct ggcgctcggc gcggtggccg ccggatcgct gtcacggggc      1260
     ccgtcggccg gcatcgagga gaccagggat cgtgttccat cggtggtccc cgagccgtcc      1320
     tcactggttc ccagccgggt accatcgcca acgggcacgc cgagcctgcc cgcctggccc      1380
     ggtcccagac ctccaggcaa caacttcacc gcgtcaacga ctccgacgcc cagcgcgtcc      1440
     tctacgggga ggcccaggcc ttctccgaca acaggcagtc caacccccca aggcccgtcg      1500
     ccgacccctt cggagagtgg caactcaccc gatccatcac caccggtgga gccgccaccg      1560
     gaaccggagc cggagccgga ggagccgacg acgggtgacg ggctaggttc ggagtag         1617
//

If you have problems or comments...

PBIL Back to PBIL home page