(data stored in ACNUC30630 zone)

EMBL: CP001738.PE65

CP001738.PE65        Location/Qualifiers
FT   CDS_pept        complement(68274..69827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0066"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: glo:Glov_0671 cell
FT                   division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95674"
FT                   /db_xref="GOA:D1ADG4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADG4"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACY95674.1"
FT                   /translation="MSSAPEQLPDQVPVQHQPRKAACLALLIFAMVMTLAAFAEVGLAR
FT                   DGRIPAGLVGYGGGLAVLAGAAYYIQARFAPYADPLLLPLAVALNGLGLAMIYRLDLST
FT                   SKDVQDAIRDGKKVVTSGLASAGTQLQWTFVAILLFALTVLFLKDSKILQRYMYTLGAC
FT                   AIVLLLLPIVPGLGAEINGARVWIFIGPFSVQPGEFAKLLLVVFFAGYLVNKRQALSLV
FT                   GKKIGPLSLPRARDLGPIMVIWLFGLGVLFIQKDLGTALLYFGLFVSMLYIATQRLSWV
FT                   LIGVGMLALGVLVATQLPFLGHVNQRLSIWQNPDPYFDGGCLVGDKVVSVAPGTEPYIQ
FT                   AGNTIGSGLTACIRMGGEYADSAQLMKGLFALGEGGVLGKGLGQGEPWRTPLAFSDFIF
FT                   DSMGEELGLTGLMVILLLYALIVQRGMKTAIAARDPFLKLFAGGVSFVLALQVFVIVGG
FT                   VTRLIPLTGLTTPFLAQGGSSLMANWILIGILVRMSHQARQPAPQAIQDEGLTQVVSIR
FT                   "
     atgagctcag cccccgagca gctccccgac caggtacccg tgcagcatca gccgcgcaag        60
     gccgcctgcc tggcgctgct gatcttcgcg atggtcatga ccttggcggc gttcgccgag       120
     gtcggcctgg cccgggacgg ccggatcccc gccggcctgg tcggctatgg cggcggtctg       180
     gcggtgctgg ccggggcggc ctactacatc caggcccgct tcgccccgta cgccgacccg       240
     ctgctgctgc cgctggcggt ggcgctgaac gggctcggcc tggcgatgat ctaccggctg       300
     gacctgtcca ccagcaagga cgtccaggac gccatccggg acggcaagaa ggtggtcacc       360
     tcgggtctgg cctccgccgg cacccagctg cagtggacct tcgtggccat cctgctgttc       420
     gcgctgacag tgctgttttt gaaggactcc aagatcctgc agcgctacat gtacacgctg       480
     ggggcctgcg cgatcgtcct gctgctgctg ccgatcgtgc ccgggctggg cgcggagatc       540
     aacggcgccc gggtgtggat cttcatcggc ccgttctcgg tgcagccggg cgagttcgcc       600
     aagctgctgc tggtggtctt cttcgccggg tacctggtca acaagcggca ggcgctgtcg       660
     ctggtgggca agaagatcgg cccgctgtcg ctgccgcgcg cccgggacct gggcccgatc       720
     atggtgatct ggctgttcgg gctgggcgtg ctgttcatcc agaaggacct gggcaccgcg       780
     ctgctgtact tcgggctgtt cgtgtcgatg ctctacatcg ccacgcagcg gctgtcgtgg       840
     gtgctgatcg gcgtgggcat gctggcgctg ggcgtgctgg tggccaccca gcttccgttc       900
     ctgggccacg tcaaccagcg gctgagcatc tggcagaacc ccgaccccta cttcgacggc       960
     ggctgcctgg tgggcgacaa ggtcgtctcg gtggcgccgg gcaccgagcc ctacatccag      1020
     gccggcaaca ccatcggctc cgggctgacc gcctgcatcc ggatgggcgg cgagtacgcc      1080
     gacagcgccc agctgatgaa gggcctgttc gcgctgggcg agggcggtgt gctgggcaag      1140
     ggcctgggcc agggcgagcc gtggcgcacc ccgctggcct tcagcgactt catcttcgac      1200
     tccatgggcg aggagctcgg cctgaccggg ctcatggtga tcttgctgtt gtacgcgttg      1260
     atcgtgcaac ggggcatgaa gaccgccatc gcggcccgtg atcccttcct caagctcttc      1320
     gccgggggcg tctcgttcgt cctggcgctg caggtgttcg tcatcgtcgg aggcgtcacc      1380
     cgcctcattc cgctcaccgg tctgacgacg cccttcctgg cgcagggcgg ctcgtccctg      1440
     atggccaact ggatcctgat cggcatcctg gtgcggatga gccaccaggc gcgccagccc      1500
     gccccgcagg ccatccagga cgagggcctc acccaggtgg tgagcatccg atga            1554
//

If you have problems or comments...

PBIL Back to PBIL home page