(data stored in ACNUC30630 zone)

EMBL: CP001738.PE79

CP001738.PE79        Location/Qualifiers
FT   CDS_pept        83961..85175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0080"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   afw:Anae109_1425 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95688"
FT                   /db_xref="GOA:D1ADH8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADH8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACY95688.1"
FT                   /translation="MHVLRLCPVFEPPATALLGRGARFAPIGGMHSHTAQLTRALDELG
FT                   VRQTVVTTRPPTAPAVARLGRHCRVVRLGASGPLSRHCYGPAAWRRAPTLVRGVDLVHA
FT                   HLGEDPVVMPLALRTAACAGAPLVVTVHHSLQHTLRVSGPRSLLLKTVGGALERRLLEH
FT                   ADAVITLTERLHDLLPGDAVHVIPSGLGPEFTARSPARTWRMPDGDAVRPRLGYVGRLQ
FT                   AHKSVDVLLRAFALLGGDGGRLLIVGDGPQRPRLRRLAGRLGIAERVTFLGALSHDQIP
FT                   AVLRTLDAVVLPSRCEEFGSILPEAMHCGVPVVATQVGGIPELIEHGRSGLLVPPGSPA
FT                   RLADALRRLLGDPGLAAAMAGRARRRVRGHTWDRLARRVLKVYQSVLTTPAPQPLPASK
FT                   VVPIK"
     atgcatgtgc tccgtctgtg tccggtgttc gagcccccgg ccaccgccct gctggggcgc        60
     ggcgcgcgct ttgctccgat cggcggcatg cacagccaca ccgcgcagct cacccgggcc       120
     ctggacgaac tgggcgtccg gcagaccgtg gtcaccaccc gtcccccgac cgcgccggcg       180
     gtcgccaggc tgggacggca ctgccgggtg gtgcggctgg gggcgtcggg accgctgtcc       240
     cgccactgct acggcccggc ggcctggcgg cgggccccga ccctggtacg gggcgtggac       300
     ctggtccacg cgcacctggg cgaggacccg gtcgtcatgc cgctggccct gcgcaccgcg       360
     gcgtgcgccg gggcgccgct ggtggtgacc gttcaccaca gcctgcagca cacgctgcgg       420
     gtgagcgggc cccggtcgct gctgctgaaa accgtcggcg gagcgctgga gcggcgcctg       480
     ctggaacacg cggacgcggt gatcacgctg accgagcggc tgcacgacct gctgcccggc       540
     gacgccgttc acgtcatccc ctccgggctc ggtcccgagt tcaccgcgcg atcgccggcg       600
     cggacatggc ggatgccgga cggcgatgcg gtgcgtccca ggctcggcta tgtgggcagg       660
     ctgcaggccc acaagagcgt cgacgtcctg ctgcgggcct tcgcgctgct gggcggcgac       720
     ggcgggcgcc tgctcatcgt cggggacggg ccgcagcggc cccggctgcg gcggctggcc       780
     ggccggctgg ggatcgccga acgcgtcacc ttcctgggcg ccctgtccca cgaccagatc       840
     ccggccgtcc tgcgcacgct ggatgcggtg gtgctgccgt cccgctgtga agagttcggc       900
     tcgatcctgc cggaggccat gcactgcggc gtccccgtgg tggccaccca ggtcggcggc       960
     atccccgagc tgatcgagca cggccgcagc gggctgctgg tgccgcccgg ctccccggcc      1020
     cgcctggcgg acgcgctgcg ccggctgctg ggcgatcccg ggctggccgc cgccatggcc      1080
     ggccgcgccc gccgtcgggt ccgcggccac acctgggacc gcctggcccg gcgcgtgctg      1140
     aaggtctacc agtcggtcct cacgactccg gcgccacagc ccttgcccgc gtccaaagtc      1200
     gttccgatca aatga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page