(data stored in ACNUC30630 zone)

EMBL: CP001738.PE87

CP001738.PE87        Location/Qualifiers
FT   CDS_pept        complement(90847..91113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95696"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADI6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95696.1"
FT                   /translation="MTRMNIDIDEEALAELMELLETDDRDKAVNLAVQATAVRVRLAKP
FT                   AQRELAELFASGALDLEALEQPWRQRHSSRTPAHSTDSTESLP"
     atgacacgga tgaacatcga catcgacgaa gaggccctcg cggagctgat ggagctcctt        60
     gagaccgatg accgcgacaa ggcggtgaac ctggcagtgc aggcgacggc ggtgcgcgtc       120
     cggctggcca agcccgcgca gcgggagttg gccgaactct tcgcctcggg agcacttgac       180
     ctggaggcat tggagcagcc atggcggcag aggcattcct cgcggacacc agcgcattcc       240
     accgactcga cggaatccct gccatag                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page