(data stored in ACNUC30630 zone)

EMBL: CP001738.PE9

CP001738.PE9         Location/Qualifiers
FT   CDS_pept        13548..13967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0009"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: cti:RALTA_B0884 putative
FT                   transcriptional regulator, AraC family, isolated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95618"
FT                   /db_xref="GOA:D1ADA8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADA8"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACY95618.1"
FT                   /translation="MKDLARLRRVRDRIDREYAQPLNVEALARDVHMSAGHLSREFRRA
FT                   YGESPYSYLMTRRIERAMALLRRGDMSVTEVCFAVGCSSLGTFSTRFTELVGVPPSVYR
FT                   RMAADATKGMPSCVAKQVTRPVRNREARVLVPHLA"
     ttgaaggacc tggcgcggtt gcggcgggtg cgtgatcgga tcgatcggga gtacgcacag        60
     ccgttgaacg ttgaggcgct ggctcgggat gtgcacatgt cggccgggca tctcagccgg       120
     gagtttcggc gtgcctatgg ggagtcgccg tactcctatc tgatgacgcg gcgcatcgag       180
     cgggccatgg cgctgttgcg gcgtggggat atgagcgtca ccgaggtctg ctttgcggtc       240
     gggtgctcgt cgttggggac gttcagcact cgtttcaccg agctggtggg ggtgccgccg       300
     agtgtctacc ggcggatggc ggcggacgcc accaagggga tgccttcctg cgtggccaag       360
     caggtgacca gaccggtcag aaatcgagaa gcgcgggttt tggtgccgca tctagcgtga       420
//

If you have problems or comments...

PBIL Back to PBIL home page