(data stored in ACNUC7421 zone)

EMBL: CP001743.PE102

CP001743.PE102       Location/Qualifiers
FT   CDS_pept        complement(81005..81487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0103"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   InterPro IPR007272; KEGG: tcx:Tcr_0170 hypothetical
FT                   protein; SPTR: A3UA77 Putative uncharacterized protein;
FT                   PFAM: YeeE/YedE family (DUF395)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26884"
FT                   /protein_id="ADD26884.1"
FT                   /translation="MALPIRDEFELHNKARTPGVAGLLAYLPYLLAGAFFGFVAIRSEI
FT                   ASWYRIYEMFRFESFHMYGVIGSAVVTAALSLWLLRKLGVKAPDGEPLRVRPADPGRYR
FT                   YLLGGVVFGLGWGLVGACPGPIYALLGSGYAGALVILLGALLGTYVYGLVQRHLPH"
     atggcgctcc cgattcgtga cgagttcgag ctgcacaaca aagcccgcac ccctggcgtg        60
     gcgggcttgc tggcgtatct gccctacctg ctggctgggg ctttctttgg ttttgtggcg       120
     atccggagcg agatcgcctc gtggtaccgc atctacgaga tgttccgctt cgagtcgttt       180
     cacatgtacg gggtgatcgg cagcgcggtg gttaccgcgg ccctttcgct ctggcttctg       240
     cggaaactgg gggtgaaagc gccggacggc gagcccctgc gcgtgcggcc cgccgatccg       300
     gggcgctacc gctacctgct gggcggggtg gtgtttgggc tgggctgggg gctggtgggg       360
     gcctgccccg gccccatcta cgcgctgttg ggcagcggct atgccggggc gctggtaatt       420
     ctgctggggg cgttgctggg cacctatgtg tatggcctgg tgcagcgcca cctgccgcac       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page