(data stored in ACNUC7421 zone)

EMBL: CP001743.PE105

CP001743.PE105       Location/Qualifiers
FT   CDS_pept        complement(83442..83807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26887"
FT                   /protein_id="ADD26887.1"
FT                   /translation="MLRPLLLLLLAFALSSCILLVEEDEPRRPVQPVTPVTPVQPSIVT
FT                   PGPGSFTYRCSGGTLVVNYLDSNNLRLFYDGAFQSLSLVRRSPTLLFSGGAYTWEWTGS
FT                   RGTLTVRGQVVLSNCAL"
     atgcttcgcc cgcttttgct tcttttgctg gcttttgccc tctcctcgtg catccttctg        60
     gtggaagagg acgagccccg gcgaccggta cagcctgtta cgccggtcac cccggtacag       120
     cccagcattg tgacgcccgg ccccggcagc tttacctacc gttgcagtgg gggcacgctg       180
     gtggtgaact atctcgacag caacaacctg cggcttttct acgacggcgc ttttcagagc       240
     ctgagcctgg tgcggcgcag cccgaccctg ctgtttagcg gcggggccta cacctgggag       300
     tggacgggca gtcgtggcac ccttacggtg cggggccagg tggtgctgag caactgcgcc       360
     ctataa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page