(data stored in ACNUC7421 zone)

EMBL: CP001743.PE107

CP001743.PE107       Location/Qualifiers
FT   CDS_pept        complement(84449..85753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0108"
FT                   /product="E3 binding domain protein"
FT                   /note="PFAM: E3 binding domain protein; InterPro IPR004167;
FT                   KEGG: actin binding; SPTR: Q58NA5 Plus agglutinin
FT                   (Fragment); PFAM: e3 binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26889"
FT                   /protein_id="ADD26889.1"
FT                   /translation="MSEVKITPLARRLAEENSIDWRQIKGTGPDGTVVERDILAFLAKV
FT                   MAGEVNLPPTPEEVAPPTGAIPDMAQAQAVLQKEGVQLDDLVPSSPSAPPPPESALPTL
FT                   EDIEFDLDLEPAPPPPVPPASAAFEEAPTLAPEPEIVPNFEEPEPLTSTGPLSTLQWEE
FT                   PEPLSPLPEVNPELASLPPLPSEPDLEPPSSANKLIWETQEVLTAPEVPAPAPEPLAPG
FT                   MSFTNTPEAPSAEPAVPPAPEHQAPVEAAAAPLTPPAASIPTPFANTGLGVGPAPSTQM
FT                   LRVQAWQRLVAIGPAQEAAQTLSEAWRMEVGLDALLYRAADKALSDTQTPLRPTKGHLE
FT                   GNELKSLRVAPAQSLRGTLDSLRMASDPAEGLVVLSLANSAFDQVIFPGLSTLTLGRAS
FT                   GGHALLTLSGDMSSELAGQLLARVAYYLERPILLA"
     atgagcgaag tcaaaatcac accgctggcc cgtcgtctgg cggaagaaaa cagcatagac        60
     tggcgtcaaa ttaagggcac cggccccgat ggcacggtgg tagagcggga tattctggcc       120
     tttttggcca aggttatggc cggcgaggtc aacctgccac ccacccccga ggaggtggcc       180
     cctccgactg gcgccattcc ggatatggcc caggcccagg cggttctgca gaaggaaggg       240
     gttcagctcg acgacctggt gccctcgagc cccagcgccc ccccaccacc ggaatcggcc       300
     ctgcccaccc tggaagacat cgagttcgac ctcgacctcg agcccgcccc tccccccccg       360
     gtacccccgg ccagcgcggc cttcgaggaa gcccccaccc tggcccccga gcccgagatc       420
     gtacccaatt tcgaagagcc tgagccgctt acaagcaccg ggcctctttc caccctccag       480
     tgggaggagc ccgagcccct gagcccgctc cccgaggtca accccgagct agccagccta       540
     ccccccctgc ccagtgagcc cgacctcgag ccccccagca gcgccaacaa gctgatctgg       600
     gaaacccagg aagtcctgac cgcccccgag gttcctgccc ctgcgcccga acccttggcg       660
     cccggaatga gcttcaccaa cacccccgaa gctccttcgg ctgagccagc ggttccacct       720
     gcacctgagc accaggcccc ggtcgaggca gccgcagcgc ccctgacacc ccccgcggct       780
     tccataccca cccctttcgc taacaccggt ctaggcgtgg gccccgcacc cagcacccag       840
     atgctgcggg ttcaggcctg gcagcgcctg gtggcgattg gccccgcgca agaggccgcc       900
     caaaccctaa gcgaggcctg gcgtatggag gtggggctgg atgccctgct gtaccgggcc       960
     gccgacaaag ccctatccga cacccagacc cccctgcgcc ccaccaaggg tcacctcgag      1020
     ggcaacgagc tcaaaagcct gcgggtggcc cccgcccagt cgctgcgggg caccctggac      1080
     tcgctgcgca tggcctccga tcccgccgaa gggctggtgg tgctctccct ggcaaacagc      1140
     gccttcgacc aggtcatctt tcctggcctc tccaccctca ccctgggccg ggccagcggc      1200
     ggccatgctt tgctcacact cagcggtgat atgagctctg agctggccgg ccagcttttg      1260
     gcgcgcgtgg cctactacct cgagcgcccc atcctgctgg cctaa                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page