(data stored in ACNUC7421 zone)

EMBL: CP001743.PE110

CP001743.PE110       Location/Qualifiers
FT   CDS_pept        complement(88965..89672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0111"
FT                   /product="molybdopterin converting factor, subunit 1"
FT                   /note="TIGRFAM: molybdopterin converting factor, subunit 1;
FT                   PFAM: molybdopterin biosynthesis MoaE protein; thiamineS
FT                   protein; InterPro IPR003749:IPR003448:IPR010034; KEGG:
FT                   mxa:MXAN_2564 molybdopterin converting factor, subunits
FT                   1/2; COGs: COG0314 Molybdopterin converting factor large
FT                   subunit; SPTR: A4KLL7 MoaD-moaE fusion protein moaX; PFAM:
FT                   MoaE protein; ThiS family; TIGRFAM: molybdopterin
FT                   converting factor, subunit 1, non-archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26892"
FT                   /protein_id="ADD26892.1"
FT                   /translation="MRVQVLLFALFREQAGQARLQLELPEGSTVADVKALLEAQYPLRL
FT                   SGGLAAINEQLAQPHQPLKDGDELAFLPPVSGGSTTPAADPALATGNESFGLTYEALAL
FT                   QPWVDWASDHPYGAVVSFLGTTRSPNKGLLVSYLEYEAYPGMAEKVMQQIIAEMRARWV
FT                   LGRVALWHRLGRVLPGEGSILIVVSAPHRPEAFEACRYAIERVKQILPVWKKEFLPDGS
FT                   HWVEGHAPEEHRL"
     atgcgcgtac aggtgttgtt gtttgccctt ttccgcgagc aggccggaca ggcccggttg        60
     cagctcgagc tgccagaagg ttccaccgtg gccgatgtca aagccctgct ggaagcccag       120
     tatcccctgc ggctcagcgg cgggctggcc gccatcaacg aacagctcgc ccagccccac       180
     cagccactca aggacggtga tgagctggct ttcttaccgc cggtatcggg cggatccact       240
     acacccgccg ctgacccagc cctggccact ggaaacgaaa gctttggcct gacctacgaa       300
     gccctggccc tgcaaccctg ggtagactgg gcttcagacc acccctacgg cgcggtggtt       360
     agctttttgg gcaccacccg tagccccaac aaaggcctgt tggtgagcta tctggagtac       420
     gaggcctacc ccggcatggc cgagaaggta atgcagcaga ttatcgccga gatgcgcgcg       480
     cgctgggtgc tgggccgggt ggccttgtgg caccgcctgg gccgggtgct gcccggcgag       540
     ggctccatct taatagtggt ttcggccccc caccgccccg aggctttcga agcctgccgc       600
     tatgccattg agcgggtcaa acaaatcctt ccggtttgga aaaaggaatt cctgcccgac       660
     ggctcccact gggtagaggg gcatgcaccg gaggaacacc gcctttaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page