(data stored in ACNUC7421 zone)

EMBL: CP001743.PE111

CP001743.PE111       Location/Qualifiers
FT   CDS_pept        complement(89736..90641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0112"
FT                   /product="regulatory protein DeoR"
FT                   /note="PFAM: regulatory protein DeoR; SPTR: A2UB58
FT                   Heat-inducible transcription repressor HrcA; InterPro
FT                   IPR001034; COGs: COG1420 Transcriptional regulator of heat
FT                   shock gene; KEGG: cvi:CV_1608 heat-inducible transcription
FT                   repressor; PFAM: DeoR-like helix-turn-helix domain;
FT                   TIGRFAM: heat shock gene repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26893"
FT                   /protein_id="ADD26893.1"
FT                   /translation="MTERQRRILHLLVDIYIQTQAPVPSGVLAQQLSLSPATVRYDLIE
FT                   LEQQGLIGKPHTSAGRVPTRAGFHHYALSKLPPNPLPQAMLEKLAQVLEDAGPRREALL
FT                   VQVASKLAGYPATLRLRPQRAPKLLQVHLSNLTSGKVLAVAVLEGGRVREARIELSFTP
FT                   TEAQLNEAEQRLYKASEPVKASTPAMMELYESIGRAFAQGSQEEYREGMGLLLSEPEAQ
FT                   NPLFLRQAIAVFEAPSDSTFTPPGGVNVRVGENEGLSLVQAGIKVNDQIGELTLLGPVR
FT                   MRYERALSVAFTMSQVYMGK"
     atgaccgagc ggcagcggcg catactgcat cttctggtag acatctacat ccagacccaa        60
     gcccccgtgc cttcgggggt actggcccag cagttgtcgc tttcgccggc caccgtgcgg       120
     tacgatctga ttgagctcga gcagcaaggc ttaatcggca aaccccacac ttcggcgggt       180
     cgtgtaccca cccgcgccgg attccatcac tacgcgctct ccaaactacc ccccaacccc       240
     ttacctcagg ccatgctaga aaagctagcc caggtactgg aggatgccgg cccaagacga       300
     gaggcgctgc tggtgcaggt agcctccaag ctagccggtt accccgccac cctgcggcta       360
     cggccccagc gtgcacccaa actgttgcag gtgcaccttt ccaacctgac atctggcaaa       420
     gttctggcgg tggcggtact ggaaggtggg cgggttcgcg aagcccgcat cgagctatcc       480
     ttcacaccca ccgaagccca gctcaatgag gctgagcaac gcctgtacaa agccagcgag       540
     ccagttaagg ccagcacacc cgccatgatg gaactgtacg agtccatcgg aagggccttc       600
     gcccagggca gccaggagga gtaccgcgag ggaatgggtc tcttgctcag cgaacccgag       660
     gctcaaaacc ctctgttttt gcgccaggcc attgcggtgt tcgaggcccc cagcgactcc       720
     acctttaccc cgcccggcgg cgtgaatgtt cgggtcggcg aaaatgaagg gctttcgctg       780
     gtgcaagccg gcattaaagt caacgaccag atcggcgagc taacccttct gggcccggtt       840
     cgcatgcgct acgaaagggc cttatcggtg gcttttacca tgagccaggt gtatatggga       900
     aagtga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page