(data stored in ACNUC7421 zone)

EMBL: CP001743.PE113

CP001743.PE113       Location/Qualifiers
FT   CDS_pept        90898..92259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0114"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; InterPro IPR010256:IPR001905;
FT                   KEGG: scl:sce2376 ammonium transporter; COGs: COG0004
FT                   Ammonia permease; SPTR: Q8PYW6 Ammonium transporter; PFAM:
FT                   Ammonium Transporter Family; TIGRFAM: ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26895"
FT                   /protein_id="ADD26895.1"
FT                   /translation="MKNLRLPFGLAALLGGLAFAQDPEFSAADTAWMLVATGLVLLMTP
FT                   ALAFFYGGMVRSKNALNTMMMSFSALGFVAVAWALLGYTLALSGDGNFIGDLRYLFLNN
FT                   VGMENKGAIVSITIPHMLWMIFQGTFAIITAALISGAVVERMRFPAFLLFITLWSLLVY
FT                   APIAKWVWGGGFLADLGAWDFAGGTVVHINSGIAAVVAALVLGARKDFGRQAVLPHNVP
FT                   FVLLGAALLWFGWFGFNAGSAWAASATAGLALTNTILAPAATIVAWSLIDLMRTGRVTA
FT                   VGLATAIVVGLVVITPAAAFVSPFYALVMGAIGAFPSYFVLLWRARSGMDDSLDVFAAH
FT                   GVGGITGAILTGVFAQKSVNGLFDGLIAGNPAQVLIQAFAVLIAVVYSGAITFVLLKLV
FT                   GAITPLKATIKEEGVGMDVSQHGEEAYTSGEGAILVKSETAMPMARPKPAGGTD"
     atgaaaaacc ttcgactacc gtttggcttg gcggcattgc tgggtggcct ggcttttgcc        60
     caagaccctg agttcagcgc tgccgacacc gcctggatgc tggtggctac cggcctggtt       120
     ctgctaatga cgccggcgct ggctttcttt tatgggggga tggttcgctc aaaaaacgcc       180
     cttaacacca tgatgatgag cttctcggcg ctgggctttg tggctgtggc ctgggccttg       240
     ttgggctaca ccctggccct ctccggggat ggcaacttta tcggtgacct gcgctacttg       300
     ttcttgaaca acgtgggtat ggagaacaag ggggcgattg tttccatcac cattccccac       360
     atgctttgga tgatctttca gggaaccttt gccattatca ccgcggccct gatctccggt       420
     gcggtggtag aacggatgcg cttcccggcc tttttgctgt tcatcaccct ctggagcctt       480
     ctggtttacg cgcccattgc caaatgggtc tgggggggtg gcttcctggc tgacctgggg       540
     gcctgggact tcgccggcgg tacggtggta cacatcaact ccgggattgc cgcggtggta       600
     gcagccctgg tgctgggggc ccgcaaagat tttggacggc aggccgttct accgcacaac       660
     gtgccttttg tcttgctggg ggcggcgttg ttgtggtttg gctggtttgg ctttaatgcg       720
     ggcagcgcct gggcggccag cgccacggcc gggctggccc tgaccaacac catcctggcc       780
     cccgctgcca ccattgtggc ctggtcgctc atcgatctga tgcggacggg gcgggtgacc       840
     gctgtggggc tggctaccgc gattgtggtg ggcctggtgg tgattacccc tgcggctgct       900
     tttgtctctc ccttctacgc actggtgatg ggagcgatag gggccttccc cagctatttt       960
     gtgctcttat ggcgggccag gagtgggatg gatgactcgc tggatgtgtt tgcagcccat      1020
     ggggttggcg gaattacggg tgcgatcctg accggggtgt ttgcccagaa gtcggttaac      1080
     ggtttgtttg atggtctgat tgcaggtaat ccggcccagg tgctgatcca ggcctttgcc      1140
     gtgcttatag cggtggtata cagcggggcc attacctttg tgctgctcaa gctggtgggt      1200
     gccattaccc ccctcaaggc gactatcaag gaagaagggg tgggtatgga tgtaagccag      1260
     cacggcgaag aggcctacac cagcggtgaa ggggccatcc tggtcaagag cgagaccgct      1320
     atgccgatgg cccggcctaa gccggcgggt ggcaccgact aa                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page