(data stored in ACNUC7421 zone)

EMBL: CP001743.PE116

CP001743.PE116       Location/Qualifiers
FT   CDS_pept        complement(93543..94655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0117"
FT                   /product="twitching motility protein"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; SMART: AAA ATPase; InterPro
FT                   IPR001482:IPR003593:IPR006321; KEGG: ppd:Ppro_3178
FT                   twitching motility protein; COGs: COG2805 Tfp pilus
FT                   assembly protein pilus retraction ATPase PilT; SPTR: A1HQ23
FT                   Twitching motility protein; PFAM: Type II/IV secretion
FT                   system protein; TIGRFAM: pilus retraction protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26898"
FT                   /protein_id="ADD26898.1"
FT                   /translation="MTFPELLASLVAKGVSDIHLHVGLPIMARLHGRLIPITQSPLTPQ
FT                   YTEALVDLMCNERQKALFAERSQVDLAYGVPGVARFRVNLFKQRGSVSCVMRVVNSDES
FT                   KLKIVSLPQDTINYFRDKEKGLVLVTGPTGSGKSTTLARIIDEINQHHSKMIVTLEDPI
FT                   EYLHRSKKSIVVQREIGQDAPSFKDGLVAAMRQDPDVIMIGEIRDHATAAAALEAAQTG
FT                   HLVFSTLHTLDTVRTVNRVLDLFPPHEREVARILFAESLVGIVSQRLLPSKQGGRVCAM
FT                   EILKGNLRIRDLIRDPDRTNEIYEALKDSSLDGMQTFDDHLAELYARDQIDLETALAHA
FT                   TSAQYVKVKALQINAARQTLIDESVVQQSN"
     atgacctttc ctgagctact cgccagcctg gttgccaaag gagtttcaga catccatttg        60
     cacgtgggcc tgcccatcat ggcccgcctg catggtcggc ttatccccat tacccaaagc       120
     ccgcttaccc cgcagtacac cgaggcgctg gtagacttga tgtgcaacga acggcagaaa       180
     gccctcttcg ccgaacgcag ccaggtagac ctggcctatg gcgtgccggg cgtggcccgc       240
     ttcagggtta acctgttcaa gcagcgcggc tcggtaagct gcgtgatgcg ggtggttaac       300
     tccgacgaga gcaagctcaa aatcgtctca ctgccccagg acaccatcaa ctacttccgc       360
     gacaaagaaa agggtttggt gctggtcacc ggccccaccg gctcgggaaa atccaccacc       420
     ctggcccgca tcatcgatga gatcaaccag caccactcca agatgatcgt caccctggag       480
     gatcccatcg agtacctgca ccgcagcaag aagtctattg ttgtgcagcg ggagattgga       540
     caggatgccc ccagctttaa agacgggctg gtcgcagcca tgcgccagga tcctgatgtc       600
     atcatgatcg gcgagattcg ggatcacgcc accgccgctg ccgccctgga agcagcccag       660
     accggccacc tggtcttctc taccctgcac accctcgata ccgtgcgcac cgtcaaccgg       720
     gtgctcgacc tgtttccacc ccacgaacgg gaggtggccc gcatcctctt tgctgagtcg       780
     ctggtgggga ttgtctctca gcgccttctg cccagtaagc aaggggggcg ggtgtgcgcc       840
     atggaaatcc tcaagggcaa cctacgcatt cgcgacctca ttcgagaccc cgatcgcacc       900
     aacgaaatct acgaggccct caaagactcc tcactggatg gaatgcagac cttcgacgac       960
     cacctggccg agctctacgc ccgcgaccaa atcgacctgg aaaccgccct ggcccacgcc      1020
     accagcgccc agtatgtcaa ggtcaaagcc ctgcagatca acgcagcccg ccagactctt      1080
     attgacgagt cggtggtgca gcagagcaac taa                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page