(data stored in ACNUC7421 zone)

EMBL: CP001743.PE119

CP001743.PE119       Location/Qualifiers
FT   CDS_pept        98639..99538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26901"
FT                   /protein_id="ADD26901.1"
FT                   /translation="MKTSSIQNSILGLLVIGMIGCVPTQTTAQQPAAPDPIAVAQQYIQ
FT                   VLNAGNLDRALAFYADDAIVHTPVGLFIGKAQIARWLASENQATRVTPRDWKMQGALVV
FT                   STGTVLLERFVKAGVGAVEFRSEYLVDRSGKIRFFGPVLTLTPEQQQKMREAQAGAPPA
FT                   PAPSVNPIEVVKAYHETANTGDFEKTFAFFADDSGAFVMNGTLLLSGKKQIADLWLRED
FT                   VKTTRVMPREYQANGNLVISMGKVSLERFRRIGVDPIAYRAQFVVENDKIRFFYPTLQF
FT                   TPEQLEKIQAAQRTPANR"
     atgaaaacca gttctattca aaacagtatt ctcggcctgc tcgtcattgg aatgatcggt        60
     tgtgtgccca cccaaaccac cgcacagcag cccgccgcgc ccgatcccat cgccgtggcc       120
     caacagtaca tccaggtgtt gaacgctggc aacctggatc gggccctggc tttttacgcc       180
     gacgacgcga ttgtgcacac cccggttggg cttttcatcg gcaaagcgca gatcgcccgg       240
     tggctggcct ccgagaacca agccacccgc gtgaccccgc gcgactggaa gatgcagggt       300
     gcgctggtgg tcagcaccgg cacggtgttg ctcgagcggt tcgtcaaagc cggggtgggg       360
     gcggtggagt ttcgcagcga gtatctggtg gacaggagcg gcaagattcg cttctttggg       420
     ccggtgctga ccctaacccc cgagcaacaa cagaaaatgc gcgaggccca ggccggtgca       480
     ccgcccgccc ctgcccccag cgtaaaccca atcgaggtgg tgaaggccta ccacgagacg       540
     gccaacaccg gcgacttcga aaaaaccttc gcctttttcg ccgacgacag cggggccttc       600
     gtgatgaatg gaaccctgct gctctccggc aagaagcaga ttgccgactt gtggttgcgc       660
     gaggatgtca agaccacgcg ggtcatgccc agggagtacc aggccaacgg caacctggtg       720
     atttctatgg gaaaggtctc gctcgagcgc ttccgcagaa ttggggtgga tcccatcgcc       780
     tatcgcgcgc agtttgtggt cgagaacgat aagattcgct tcttctatcc caccctgcag       840
     ttcacacccg aacagctcga gaagatacag gccgcgcaac gaacccccgc gaaccgctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page