(data stored in ACNUC7421 zone)

EMBL: CP001743.PE120

CP001743.PE120       Location/Qualifiers
FT   CDS_pept        99554..99808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26902"
FT                   /protein_id="ADD26902.1"
FT                   /translation="MQYFKSSAQGAKHWLEMIRDKAPSWTGLPVGDEGGLMRPDQSASY
FT                   NLVFRYREYAFLLSNHPDDSPAFYRKWAQAIIQRIQRFK"
     ttgcagtact tcaaaagcag cgctcaaggg gccaagcact ggctcgagat gatccgtgac        60
     aaagccccga gctggacagg ccttccggtt ggggacgaag ggggtctgat gcggcccgac       120
     caaagcgcct cctacaacct ggttttccgc taccgcgagt atgccttcct gctctccaac       180
     caccccgacg acagcccggc gttctatcgc aaatgggccc aggccatcat ccagcggata       240
     cagcggttca aatag                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page