(data stored in ACNUC7421 zone)

EMBL: CP001743.PE122

CP001743.PE122       Location/Qualifiers
FT   CDS_pept        101137..103350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0124"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_00157 QXW lectin repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26904"
FT                   /protein_id="ADD26904.1"
FT                   /translation="MGWQNFASTLWLRWIIVVLILGLPACSGTPPDPRAREAIIPATTK
FT                   VSDPSTRDALTLYDPETGILRFSTSTPLLDSLKIDNVLVSEPSSAAPYGYLRKIKAIRR
FT                   EGAQVVLETVQANLTDAIHQGWLEAADDLEASDLASAMALVEGLSVGVVQPTANVGDGF
FT                   RFEARFDETVLDINEGDVRVKVRVNGVFYFNAGYNIAVGIKPRFGIPPAYVDHFEAWIG
FT                   FEQRAQLQVSGEANAQVNKEKKVAEYRFKPLCFAIGPVPVCVVPTVYIFVGATGEVNLR
FT                   FSYNAVQTAQAKMGARWTDSRGWEEIEPTPAFNTSFDQNFDINAGLKTRAYTKAEGALM
FT                   LYGIAGPTIGAQMSIELDVAVPRDPFWILRGSLRAYYSFIVDIPVIGRVAEHSGTLYEI
FT                   GREFGRSPAPPPTITIRTSPATVQLRVETDLAQFFRVAHPLGNVDLTVTSNLDGTLYSG
FT                   SWSTNPNSLFGPELKRTFNTVGSRTLTLIARYVNSQTSSSLVLDVVNTPPTLNLQYGGD
FT                   PRQGQIYPITVLITDPNEPDTTRLCGSTQWSVEAPDTLSATTGCSVSVTFGTTGARQIR
FT                   VTARDSEGATTTRTLTLDVLPPPVNPYPKITGYGVYSDEYTGGPIRCGSVRVADGRTID
FT                   LNNRGCVTPHRYYGGITVENPSNEALTYDWKLYVSPPGFDNLLLSETASTSYIFELYNV
FT                   HNSGLTTNDCRVTVKVNAPDPSRSKGPITVWTGRCTYYSFTLR"
     atgggctggc agaatttcgc aagtaccctg tggcttcggt ggataatcgt cgttttaatc        60
     ttaggcttac cagcctgcag cggcacccca ccagatcctc gcgcacgcga agcgattatt       120
     ccagcaacca ccaaagtttc tgatccttcc acgcgagacg cgctcacgct gtatgacccc       180
     gagaccggaa tcctgcgttt ttcaacctcc acaccactgc tcgatagctt aaagatagac       240
     aacgtactgg tcagcgaacc ttcgtccgcc gctccctacg gttacctgcg aaagatcaag       300
     gcgattcggc gcgaaggtgc tcaggtggtg ctcgagaccg ttcaagccaa tctcaccgac       360
     gcaattcacc agggctggct cgaggctgca gacgacctcg aggcttccga tctggcctcc       420
     gcgatggctt tggtggaagg gctttcggta ggggttgttc aacccaccgc taacgtaggc       480
     gatggtttcc gctttgaagc taggtttgac gaaactgtac tcgatatcaa cgaaggggac       540
     gtcagggtca aagtgcgcgt taatggcgtg ttctacttta atgcgggcta caacatcgct       600
     gtcggcatca agccccgttt tggtattcca cccgcgtacg ttgaccactt cgaggcctgg       660
     ataggcttcg agcagcgggc gcagctccag gtctcggggg aagcgaatgc ccaagtcaac       720
     aaggaaaaga aagtggcgga ataccgcttc aaacccttgt gctttgcgat tgggccagtg       780
     ccggtgtgcg ttgtcccgac tgtctacatt tttgtgggcg caaccggtga ggttaaccta       840
     agatttagct acaatgccgt gcaaaccgct caggcaaaga tgggcgcgag atggacagat       900
     agcaggggct gggaagaaat tgagcccaca ccggcattca acacctcgtt tgaccaaaac       960
     tttgatatca acgccgggct caagacaagg gcgtacacca aagccgaagg agccctcatg      1020
     ctctacggca ttgcagggcc gaccattggc gcacaaatgt ccatcgaact cgacgtcgct      1080
     gtaccgcgcg accccttctg gattttgcgc gggagcctca gggcctacta cagcttcatc      1140
     gttgatatac ccgttatcgg aagggtagca gaacatagcg gcacccttta tgaaattggc      1200
     agggagtttg ggcgctcccc ggccccccca cccacgatca ccatcagaac cagccctgct      1260
     accgtacagc tccgggtcga gaccgacctg gctcagttct tcagggttgc ccaccccctc      1320
     gggaacgtcg acctgaccgt aacctccaat ctggacggca ccctctacag cgggagctgg      1380
     agcaccaacc ccaatagcct gtttggcccc gaactcaagc gcaccttcaa cacggtgggc      1440
     agccgaacgc tgacgctcat tgccaggtat gtcaacagcc agaccagcag cagcctggtg      1500
     ctcgacgtgg tgaacacccc gcccaccctg aacctgcaat acgggggaga cccccgccag      1560
     ggccagatat atcccatcac cgtgcttatc accgacccca acgaacccga caccacccgg      1620
     ctatgcggca gtactcagtg gtcggtggag gcacccgaca cgctatcggc cactaccggt      1680
     tgctcggtct cggttacctt tggcactacc ggtgcccgcc agatccgggt gaccgcccga      1740
     gatagcgagg gagctaccac caccagaacc ctcaccctgg atgtgctgcc cccacctgta      1800
     aacccttatc ccaaaatcac cggttatggg gtgtactcgg atgaatacac cggagggccg      1860
     atccgctgtg gctcggtgag ggtggcggat ggccgtacca ttgacttgaa caatagaggt      1920
     tgtgttaccc cccaccgcta ctatggcggt ataaccgtgg aaaaccccag caacgaggcc      1980
     ctgacctacg actggaagct ctacgtgagc cctccagggt ttgataacct tctcctctcc      2040
     gaaaccgcct ccaccagcta catctttgag ctctataacg tccacaacag cgggctcaca      2100
     acgaacgatt gccgcgtgac tgtgaaggtc aacgcccccg accccagccg cagcaagggg      2160
     cccatcacgg tctggactgg caggtgtacc tattactcat ttacgctacg ctag            2214
//

If you have problems or comments...

PBIL Back to PBIL home page