(data stored in ACNUC7421 zone)

EMBL: CP001743.PE123

CP001743.PE123       Location/Qualifiers
FT   CDS_pept        103483..104136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0125"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; InterPro IPR005834:IPR006385:IPR006383; KEGG:
FT                   pae:PA1143 hypothetical protein; COGs: COG0560
FT                   Phosphoserine phosphatase; SPTR: P66802 Uncharacterized
FT                   protein Mb0517c; PFAM: haloacid dehalogenase-like
FT                   hydrolase; TIGRFAM: Haloacid Dehalogenase superfamily,
FT                   subfamily IB, phosphoserine phosphatase-like;
FT                   HAD-superfamily subfamily IB hydrolase, TIGR01490"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26905"
FT                   /protein_id="ADD26905.1"
FT                   /translation="MSTIAADLEGTLTTGETWRGMAAWMQAHGRAAQYQWFFYRNLPGA
FT                   VAARLGLQDKRAFQDRFMEGAAGLLAGLEQAELAAMSEWVVTNELWPKRRQDVLDELLR
FT                   LRQDGRRLVLCSATYQPILEAFARRMGAGVVALGTPLEVEGGVFSGRLRGPVRSGAHKA
FT                   EHLRKFLDGEVLYRAYGDSLPDVPMLELAEEPVAVYPEPKLRALAVERNWRVIG"
     atgagcacca ttgcagcaga cctcgagggc acccttacca ccggcgagac ctggcggggt        60
     atggccgcct ggatgcaggc gcacgggcgg gctgcgcaat accagtggtt tttctaccgg       120
     aacctaccgg gggccgtggc cgcacggctg ggcttgcagg ataagcgggc ctttcaggat       180
     cgctttatgg aaggagcggc gggcttgctg gcggggttgg agcaggccga gctggccgcg       240
     atgagcgagt gggtggtgac caacgaactc tggcccaagc ggcgccagga cgtgctggac       300
     gaactcctca ggctgcggca ggacgggcgg cggctggtgc tgtgttcggc cacctaccag       360
     cccattctgg aggcgttcgc gcggcggatg ggggccgggg tggtggccct gggtacaccc       420
     ctcgaggtcg agggcggggt ttttagcggt cggctgcggg ggccggtgcg ctcgggggcg       480
     cataaagccg agcaccttcg caagttcctg gatggcgagg tgctttatag agcctatggc       540
     gacagcctgc ccgacgtacc gatgctcgag ctggccgaag agccggtggc ggtatacccc       600
     gaaccgaagc tgcgtgcact ggccgtagag cgtaactgga gggtgatcgg atga             654
//

If you have problems or comments...

PBIL Back to PBIL home page